Detailed information on CNT3099801


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30690674Oryza rufipogonOryza sativa55.03100100290forward
CNT30552118Oryza rufipogonOryza glaberrima50.6610099.63267forward
CNT30575067Oryza rufipogonOryza barthii65.6510099.71346forward

Expression of CNT3099801

Peptides detected in this lncRNA

>peptide 1 (62 aa)
MTACARSWSVPGCGVSWSRNPSSNLLSARSPLVGQCRRRLPPGFGRQSARQWWPGCPPGRTS*

>peptide 2 (53 aa)
VPTDAQVRPRLRERAVGDVGRAAAPAAGDVLDEGVGAEPTVEQVLGMVEVVEL*

>peptide 3 (50 aa)
MSASSSTGIWPSERSTMVAGVSSRTDIIGGRRESGGGARPRPMPAPAPNK*

>peptide 4 (50 aa)
YPRTRRSGHASENERSAMSDGPPLRRPEMSSMRELELNPRSSRSSAWWKW*

>peptide 5 (31 aa)
THGRAGPATPPRTSGRRCRTGRRSGGRRCPR*

>peptide 6 (34 aa)
MVVGAGFGSVTSNDGLRTELERSRLRRLLVEESK*

Sequence

>CNT3099801
GTACCCACGGACGCGCAGGTCCGGCCACGCCTCCGAGAACGAGCGGTCGGCGATGTCGGACGGGCCGCCGCTCCGGCGGCCGGAGATGTCCTCGATGAGG
GAGTTGGAGCTGAACCCACGGTCGAGCAGGTCCTCGGCATGGTGGAAGTGGTAGAACTCTGAGCCGCCGAGAGGGGATTCCTTGCCGTTAGCTATGGTGG
TGGGTGCTGGTTTTGGCTCGGTGACTTCGAATGACGGCCTGCGCACGGAGCTGGAGCGTTCCAGGCTGCGGCGTCTCCTGGTCGAGGAATCCAAGTAGTA
ATCTCTTGTCTGCAAGGAGCCCCCTGGTGGGTCAATGTCGGCGTCGTCTTCCACCGGGATTTGGCCGTCAGAGCGCTCGACAATGGTGGCCGGGGTGTCC
TCCAGGACGGACATCATAGGAGGGAGGCGGGAGAGCGGCGGAGGCGCGCGGCCGAGGCCAATGCCGGCGCCTGCACCAAACAAGTAGCCGTCCCATGACG
CGCGTGGCTCGTCCCAGGAGAAGCCAG