Detailed information on CNT3099786


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30381383Oryza rufipogonManihot esculenta3910.1984.36179forward
CNT30402401Oryza rufipogonBeta vulgaris40.9615.8286.17188forward
CNT30196370Oryza rufipogonPisum sativum38.3418.4786.36176forward
CNT30567082Oryza rufipogonActinidia chinensis40.9642.7386.7188forward
CNT30244214Oryza rufipogonAvena sativa41.1871.8687.83189forward
CNT30595566Oryza rufipogonOryza meridionalis94.9986.6898.39436forward
CNT30422340Oryza rufipogonPapaver somniferum37.0420.0782.94170forward
CNT3057379Oryza rufipogonAmborella trichopoda18.0829.7586.7583forward
CNT30119164Oryza rufipogonCitrus clementina36.3835.8485.03167forward

Expression of CNT3099786

Peptides detected in this lncRNA

>peptide 1 (38 aa)
NINNRRPASSNTVPKKVPIAQTKKQSEDIGSGRWRTRR*

>peptide 2 (34 aa)
MDVELPMKVDAMERPLGGMSQTLDFTLLGIHSTK*

>peptide 3 (40 aa)
MSSASCCSSSSYSPSSSAVASWYCCSELLAHPPEHLLDGC*

>peptide 4 (33 aa)
MPWRGLSVECHRHWTSHCWGSTRRSRMSSCSGH*

Sequence

>CNT3099786
AAATATCAACAATCGCAGACCAGCATCAAGTAATACAGTACCCAAAAAGGTTCCCATAGCACAGACGAAAAAACAAAGCGAAGACATAGGAAGCGGGCGG
TGGCGTACGAGGCGGTAATACGGTGATAATGTAAGACGGAAACACCAAGCACACAAAACCCTGCCCTAGAACCACCAAGCAAAAGCCACCTTACATGTCG
TCAGCCTCCTGCTGCTCCTCGTCCTCGTACTCGCCCTCCTCATCGGCGGTGGCATCCTGGTACTGCTGCAGTGAACTGCTCGCTCACCCTCCGGAACATC
TCCTGGATGGATGTTGAGTTGCCAATGAAGGTCGATGCCATGGAGAGGCCTCTCGGTGGAATGTCACAGACACTGGACTTCACATTGTTGGGGATCCACT
CGACGAAGTAGGATGAGTTCTTGTTCTGGACATTGATCATCTGCTCATCAACCTCCTTG