Detailed information on CNT3099753


BLAST search results

BLAST vs Swiss-Prot:
sp|Q6I544|GL52_ORYSJ, E-value = 2e-32

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30246414Oryza rufipogonAvena sativa22.6720.1485.15202forward
CNT30347816Oryza rufipogonEragrostis tef23.239.8388.89207forward

Expression of CNT3099753

Peptides detected in this lncRNA

>peptide 1 (85 aa)
MRARETPRVLSPGTFSTLAPVTTAPVVVLAAAPGLASTPEKKSATATAPRSREDHDDPAAPAILLADLSRLLAAPLLFFCSPMVN*

>peptide 2 (49 aa)
ATYYKKLLYYYYILHVALTQISVIKMALYHRQVHIVNHQITDKSIQILR*

>peptide 3 (36 aa)
SNLLQETSLLLLHFACRSYTNKCHQDGIISSTSTYS*

>peptide 4 (33 aa)
MDCVPGSWLLKAETTAAGLPPVFLWKWTRPPGA*

Sequence

>CNT3099753
AGCAACTTATTACAAGAAACTTCTCTATTACTACTACATTTTGCATGTCGCTCTTACACAAATAAGTGTCATCAAGATGGCATTATATCATCGACAAGTA
CATATAGTTAATCATCAAATCACAGACAAATCAATTCAAATTTTAAGATAAGTTTAAAACCTCAAATCTCTCCAATGTATACGTCGTCTTATAATCTTAT
ACTATCTTCTAGGTCTTCTTGGGGGCAAACTTGGCCTTGATCTTGTCCACCTCCTCGTCGTCGATCTGGAAGGCCTTGGCGAGGACGGCGTCGGGCACCG
CCGGCGAGGCGGCGAAGAGCGTGGCGGCGATGGACTGCGTGCCGGGGAGCTGGCTGTTGAAGGCGGAGACGACGGCGGCGGGATTGCCGCCGGTGTTCCT
CTGGAAGTGGACGAGGCCGCCGGGGGCGTAGTCGATGCGGGCGAGGGAGACGCCCAGGGTGTTGAGCCCCGGGACCTTCTCGACGTTGGCGCCGGTGACC
ACGGCGCCGGTGGTGGTGTTGGCAGCGGCGCCGGGGCTGGCGAGCACGCCGGAGAAGAAGTCCGCCACCGCCACCGCTCCGAGGAGCAGAGAGGACCACG
ACGACCCTGCAGCCCCAGCCATCCTGCTCGCTGATCTCTCTCGCCTGCTAGCTGCGCCTCTGCTCTTCTTCTGCTCGCCGATGGTTAATTGATTGATGTG
TGTTGACCACTTGTCGTTGAGCAATCAGAGAGGAAGAACCCGGTGCTACTTATAGCTGGGGAGGGGGTGAGACGAGGAGAAAAGATTAGGCTGGTGATTA
ATTACCGGAGTGATTGATGATCATCAGCTGTGAGTGGGTGAGAGTGTGTGTGGGTCAAAGAGCCTGACTGGCTGCTGGTGTGTGTGCTTTG