Detailed information on CNT3099748


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30369201Oryza rufipogonOryza glumipatula72.7188.6297.8818forward
CNT30574938Oryza rufipogonOryza barthii49.69102.9596.96559forward

Expression of CNT3099748

Peptides detected in this lncRNA

>peptide 1 (29 aa)
MSSRSRSSSSAKSPSSMSSVKSTSCSPFM*

>peptide 2 (46 aa)
SGKKPKKSPPKHPHSQAHHTNMNNFSKLLIHTQKSTCRNISPRPKS*

Sequence

>CNT3099748
CTCGGGGAAAAAACCCAAGAAATCTCCTCCCAAGCACCCACACTCACAGGCCCATCACACCAACATGAATAACTTTAGCAAGCTCTTAATTCACACGCAG
AAATCCACCTGCCGGAACATATCACCACGGCCGAAGTCGTAGCCGCTGGGTATCTCTGGGAAATCCTCGCAGAAGTCATCACCGATGTCGTCGAGGTCGA
GGTCATCTTCTTCAGCGAAGTCTCCAAGCAGCATGTCCTCAGTGAAGAGTACGTCTTGTTCGCCATTCATGTAAGCCGGCACATCGGAGATATCCAGAGC
ATCCAGCCCAGCTCGGAAATCCATCGGGTCAATGTCCGGCAGCTGTAGACCGCGCAGTATATCCTTGTAGAACTCTGGGTCATCCGGCAGCTCGGCGGTC
TCGTTGGTAGCCTCCACCAGGAGGGGAGTTGCAGCTTGCTCCGGCAGCGGCGGCGACTCTGGCTTTGGAGCTGGCTTGGTGGCTTCGAGCACAGACGACG
GCGAAGGGTGGGCGAATGGCGCGGCAGAAGTCGAGGACGACGAGGACGCAGTCGGAGTAGGGGTCGCCGAACTAGCAGGTGAGGCAGAGGAGGCCACACC
ACGGCGGCGCTTCTCTTCGGCGAAGTTGCGGGAGGCAGACTGGTAGGCGCACACCACGGTAGCAGGTGCTCCCAACCTTGCCGATGTTGGCGTAGGCAGC
GACGGTGGACGCCGGAGAGGCCTGCTTCGTCGACGAAGCTGGCTTGCCAATGAAGAGCTCAAAGTAGCGCTTCTTTGAGGCGGCGCCGGCGTCCTCGTCG
TCGTCAGAGTCGGAGTCCGTCGCGTCAGGGTCCTCGAACACGACGCGGACGCGACGGCTTGGCTGCAGGGAGGCCGCCGCCGACGGCACATGGGGCCTGG
AGAAAGCAGCAGAGGGTTTAAGGCCAAACCCGGATAGCCTCTTCGTCTTCGGCTTCTTCGCCATCACCTTCTTGAGGAGCATCTGCTGCTGCTTGGAAGG
GGCCATTTCTCTCTTCTTCTAACTCTTGCCGGAAAAGAACTCTAAAATTCCTCACCAAAACTGACAAAACTGAAGGGGAAAAACTCTAAAAGGGGGAAAC
TTTTTTTTTCTCTTGTGCAAAAATT