Detailed information on CNT3099740


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT002948, E-value = 4e-72

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30369385Oryza rufipogonOryza glumipatula43.149.6399.46931forward
CNT30107111Oryza rufipogonOryza longistaminata21.3458.1394.58461forward
CNT30575023Oryza rufipogonOryza barthii37.9687.5199.63820forward
CNT30115671Oryza rufipogonOryza nivara37.0485.11100800forward

Expression of CNT3099740

Peptides detected in this lncRNA

>peptide 1 (31 aa)
MSLSPSSYRPRQRYIAPTRSRKFLSSLMIPM*

>peptide 2 (70 aa)
MTYKSLGEAGRYKMVSEPGAYVAVAQAWCAWLLWTRSGHSMAYALALDTRTWPRGDVPGLGLIDGGVDLS*

>peptide 3 (46 aa)
MVRMAVVDPEWSQHGICAGTGHTDMAKRGRSWPGVDRRGRRSLLRG*

>peptide 4 (36 aa)
MIPFAFQLIKWNYFVGNLLTNTMSDPDVKCPTPMYA*

>peptide 5 (46 aa)
MGDWEPALLDVSLTLILSPASTIYSANQVQEVLKFFDDTHVADLLR*

>peptide 6 (41 aa)
MSQLRRHGAHGCCGPGVVTAWHMRWHWTHGHGQEGTFLAWG*

>peptide 7 (67 aa)
NLPQPRRPMLVYRSPMKDLGFGGSHPPDFLSRSGGGGVVRRGHTQVVVRTARGEVERRASSSLFSSP*

Sequence

>CNT3099740
AATCTACCGCAGCCCAGGAGACCCATGTTAGTCTATCGCAGCCCAATGAAGGATTTAGGGTTCGGTGGGTCTCATCCTCCTGACTTCCTGAGTCGGAGCG
GCGGCGGCGGCGTAGTGCGGCGCGGTCACACGCAGGTGGTGGTAAGGACAGCGCGCGGCGAGGTGGAGCGTCGTGCATCCTCTTCACTCTTCAGCTCACC
ATGAATAGCATCCACCGTCTCCCCCCATCGACCAGCTGCTGGCAACATACGTTTCTATCAGCAGCTAGCTGTCCTAGCTAGCCTCATCAGTTTAGCGCAT
GGATGGGAGATTGGGAGCCGGCACTGCTCGATGTCTCTCTCACCCTCATCTTATCGCCCGCGTCAACGATATATAGCGCCAACCAGGTCCAGGAAGTTCT
TAAGTTCTTTGATGATACCCATGTAGCTGACCTTCTTCGATGATACTTTGTTCCCATATCTGATTGGTTGATGTTGATATACATTGCAATGTGTAGGCAC
CAAACAAAGCAGTTGTTGTGTTCCTCTACATAGAGATTTTTACATCATCTCTGATATGTCTCATGTTTCTGTTAATTATCTCCTATCCCAGTCCACTTTC
ATGGGCTTTAAAGCTGCACTGCCAGTAAATTGAGGTGGTAAGCAGCCATCGAATCATCCGCTCCTAAAATTCTAAGCATTCGTGACAAGTTAATAGATGC
TACACTAAGACCTTGACTTTGCAACCTTCAGTCTCTAATTCTCTGCATGCATCATTTACTCCAGAGTTCTAATTAACAGGATTTCAGGTGAAGGCCATCT
GTGGATCCAAAATATATTGTTCTTTGGCTAAGATTTTAGGTCTGGCTGTTTTTCTCCATTTCATATAAGCTTTTTGAAAATATCCCATATTAAATATTTC
TATTTGAGAAACTATCTGGATACTTTGATTAATGTAACATCCCGGCCTAGGGCTTAATAGGATTAATAGAATACTCATATCAACAAGTTGCAACTTCTTT
TCCAGAAGCTGATCTCTAAAGAACTCCGAGGTTAAGCGTGCTTGGCCTGGAGCAATTTAGGTATGGGTGACCGATCGGGAAATTCTTCCCGAGTGCACAC
GAGTGAGCACAAAGTGCGCAGAAAAGACTTATGAAATTTAGGGATGGGTGACTGATCGGAAAATTCTTCCCGAGTGCGCACGAGTGAGCACAAAGTGCGC
AGAAAAGACTTGTGTTCCCTGTGAGGGCAGTCTATGACCTATAAAAGCCTAGGAGAGGCGGGACGTTACAAAATGGTATCAGAGCCGGGCGCGTATGTCG
CAGTTGCGCAGGCATGGTGCGCATGGCTGTTGTGGACCCGGAGTGGTCACAGCATGGCATATGCGCTGGCACTGGACACACGGACATGGCCAAGAGGGGA
CGTTCCTGGCCTGGGGTTGATCGACGGGGGCGTCGATCTCTCTTAAGAGGGTGAGGGTGTAACATCCCGGCCGAATTAATAGAATACTCATATCAACAAG
TTGCAACTTATTTTCCGGATGGTGGGTTTCGTGTAATTTTTGCCTTCTTTTTTTCCACTATATTCAATGAAATTGACACACCGGTGCCAGTTCATTAAAA
AGAAAAAAAAATCTGTGACGGGTTTTATACTTTAGATCTTTTTCTGTTGCAGATGAGCTGAAAAACTCTTAAAATTGGATAGCTCAAATATATGTAATAT
GTAATTGTATTTCTAAAGCTAGAGCCAGATCAATCTGCACATATTTGTTTTATGCTATTCCATCTAATTTGTAACTGCTTTTGTTTCATGTCATATATGC
AGTTGGTAATGTGGTATACAATTTGAGCTATGATATTTCAGACAGACTGAGGGCATATAGAAAGTTAAGCTTTCAGGTGCCATGATCCCATTCGCTTTTC
AATTGATTAAATGGAATTATTTTGTTGGTAATCTCTTAACAAATACTATGAGTGATCCGGATGTCAAGTGCCCAACTCCTATGTATGCTTGATGCTTCCC
TCAATGCTCATATATAAAATTGGGTCATCTTTTAGATTTTGAACCATCCACATTAGGTGAAGGTTTATTTTTGCTAAGGTATGCAGCAATCCATGATCTG
GAAGCATACAATTTTATGAATTATAGTAATGATGCCTAATAAATATATAATTTTTCAGTC