Detailed information on CNT3099540


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT000173, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30690551Oryza rufipogonOryza sativa71.1583.9199.45365reverse complement
CNT30575020Oryza rufipogonOryza barthii10064.7798.25513forward
CNT30115514Oryza rufipogonOryza nivara79.5385.7198.53408forward

Expression of CNT3099540

Peptides detected in this lncRNA

>peptide 1 (30 aa)
TEGWWAAMGSRWTPVEMWWEDRGTSHARGW*

>peptide 2 (40 aa)
MVGGDGVSLDSGGDVVGGSWDESCAWMVNRVICRWILEEM*

>peptide 3 (41 aa)
MRLGRSSPPRPPTTVDLASSTAASLDLLHPQLPATSNRGVA*

>peptide 4 (55 aa)
LRDGGRRWGLAGLRWRCGGRIVGRVMRVDGEPCDLQVDPGRDVSRRSPPHNPNRS*

>peptide 5 (60 aa)
MTATRTSTSPIQICALAGARHLDRPPPWTSPPRPLPPSICSIHSFPRQATAASPENDSRR*

Sequence

>CNT3099540
GACTGAGGGATGGTGGGCGGCGATGGGGTCTCGCTGGACTCCGGTGGAGATGTGGTGGGAGGATCGTGGGACGAGTCATGCGCGTGGATGGTGAACCGTG
TGATCTGCAGGTGGATCCTGGAAGAGATGTGAGCCGTCGCAGCCCTCCTCATAACCCGAACAGAAGCTAGACATCAAGACAATGACGGCGACGAGGACCT
CGACCTCGCCCATCCAGATATGCGCCTTGGCAGGAGCTCGCCACCTCGACCGCCCACCACCGTGGACCTCGCCTCCTCGACCGCTGCCTCCCTCGATCTG
CTCCATCCACAGCTTCCCGCGACAAGCAACCGCGGCGTCGCCTGAGAACGATTCACGGCGGTGACAACGCAGTGGCGCGGTGGCGGCGTGACAGTAGCCA
AGGACGACTCACCTCCCCACACTGCCGTCGCTCCCGCCCCTCAGATCCGACATCGACGTGGTGGGGGAGGACGGCGATGGCGGCGTGGTGGGGGAGCGAC
GCGGTGGGGGAGC