Detailed information on CNT3099522


BLAST search results

BLAST vs Swiss-Prot:
sp|A7QEU4|PER5_VITVI, E-value = 8e-56

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30523062Oryza rufipogonSetaria italica15.1332.9888125forward
CNT30552396Oryza rufipogonOryza glaberrima74.0976.8896.73612forward
CNT305663Oryza rufipogonZea mays11.6237.583.3396forward
CNT30575036Oryza rufipogonOryza barthii4634.4291.05380forward
CNT30116812Oryza rufipogonOryza nivara6.324.4188.4652forward

Expression of CNT3099522

Peptides detected in this lncRNA

>peptide 1 (48 aa)
MSAQETTRGHAASTAALAASITSNPRRLGLFGGAVFSVSFPSIKTEASQ

>peptide 2 (53 aa)
MTGSHQNTRPNTETQSKTENKLNNKKKKKLPLQQLLFSRKAAASNTDRSQTYC*

>peptide 3 (54 aa)
MVWAPESTTMSSAVSDLLAKRPTSSVALKVGGGRLSSASWAMETLPSRRPAGTL*

Sequence

>CNT3099522
ATTGAATATGCAATTGAATCATGCATGCTATTTTATTAGCAGTTGGTAATTACGTTCAATGTAGTCTATAATGGAAACTGAATATGCAATTCGTCAACAT
TTCGCCAAATTTTTTCCTTGATTCATGACAGGTTCGCACCAAAACACTCGCCCAAACACTGAAACACAATCCAAAACAGAAAACAAATTAAACAACAAGA
AGAAGAAAAAACTTCCTCTCCAGCAACTCTTATTCTCGCGAAAAGCAGCAGCTAGCAACACCGATCGATCACAAACTTATTGCTGAAATCTCTGAAGAAC
ACCACATCAGCTACTACCTTAATTAGCTCGCTGCCACTTGATCCCCATCATCCATGGCGGCGAGCTCGAGCTCAGCGTTGGCGGGGCTGATCGCCGGGTC
GGCGTCGCCGACGCCGGTGAAGTTGTAGAGGCGCGGGGTGAAGGAGTCGCAGTGGGAGACGCCGATGGTGTGGGCGCCGGAGAGCACCACCATGTCCTCG
GCGGTGAGCGACTTGTTGGCGAAGCGGCCGACGAGCTCCGTGGCGTTGAAGGTGGGAGGGGGCAGGTTGTCGAGCGCGTCCTGGGCGATGGAGACGTTGC
CGTCGCGGCGGCCGGCGGGGACCTTATAGGTGACGTTGCCGGTGAGCGCGACGGAGTCGCGGGCGGCGAAGGCGAGGATGTCGGCGCAGGAGACGACGCG
CGGGCACGCCGCCTCGACGGCGGCCTTGGCGGCGTCGATCACCTCGAATCCCCGGAGGCTGGGGTTGTTTGGTGGCGCGGTCTTCTCGGTGTCGTTCCCG
TCGATCAAAACCGAGGCGTCGCAGCC