Detailed information on CNT3099497


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONOSAT000057, E-value = 6e-124

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30690133Oryza rufipogonOryza sativa92.4799.5799.85688forward
CNT30105868Oryza rufipogonOryza longistaminata69.2253.1596.5515forward
CNT30575074Oryza rufipogonOryza barthii83.8798.5899.52624forward

Expression of CNT3099497

Peptides detected in this lncRNA

>peptide 1 (54 aa)
FHYPSHGQLFIINTHLFRCHTFLKFCRFCASMMTWLLSKFKTVTFSLHQFFGSF*

>peptide 2 (29 aa)
MGSQGKVLPHLMLNGCLTSCGNLHLHNHS*

>peptide 3 (47 aa)
MEKSGPCFLFHHLQMYHSPLLQLDPLLTCLKYCESQLHNLSEAPPYK*

Sequence

>CNT3099497
TTTCACTATCCTTCTCATGGTCAGCTTTTCATCATAAACACGCACCTCTTCAGGTGCCATACTTTCCTTAAGTTCTGTCGATTTTGTGCCTCTATGATGA
CCTGGCTTCTTTCGAAGTTTAAAACTGTCACCTTTTCTCTCCATCAATTCTTTGGCAGCTTTTAACCGAGCTTCAGCAAACTCCATTGCTTCTTTGATAG
CAGCAGCAGCAGCAGCTGAGTTAGTACTGACTTCAGAATCTCCATTTGCTTTACTTTCCTTTTTATTAAGCAATTTGGATGGTGGCTGTACTTTGATGGG
TTGTGTGTGAAGGCTGTTATTTGGGACCCTTAAGAATGGGTAGTCAGGGGAAGGTACTTCCTCACTTGATGCTGAATGGGTGCTTAACCTCTTGTGGTAA
TCTTCATCTTCACAATCATTCTTAGAAATTGGATGACATGTTGGTGTGTGCAGGTTCTGATCAGCCACAGAATCACTACTAGCACTCTTCAGGCTTGAAC
TTGATGGAAAAGTCAGGCCCATGCTTCCTTTTTCACCATTTGCAAATGTATCACAGTCCACTACTACAACTTGATCCATTGCTGACTTGTTTGAAATATT
GCGAGAGTCAACTACATAACTTATCGGAGGCTCCACCATACAAGTAGTCATTTTAACTATATCATCTGGTCTTCCCCTGGTAGCCTTGTTATATGACATA
CTAAACTGTTTCCCACTATCCGGAGGAGAGGAGATTGGAGAAAA