Detailed information on CNT3099490


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30344950Oryza rufipogonEragrostis tef3774.7981.14175forward
CNT30106638Oryza rufipogonOryza longistaminata50.1110099.16237forward
CNT30575022Oryza rufipogonOryza barthii50.1110099.58237forward
CNT30115513Oryza rufipogonOryza nivara49.05100100232forward

Expression of CNT3099490

Peptides detected in this lncRNA

>peptide 1 (34 aa)
MKTTNLLKLSFAPLTALLIDWQEDHTDSILAWLR*

>peptide 2 (28 aa)
MPAPSPVFFSQPQAPRCAILSSISRASLT

>peptide 3 (60 aa)
CCSKSASELELLVRKTCSITGSVWSADSPKSELSVGTRRHPSITCPSDSATWINESNRKH*

Sequence

>CNT3099490
CTGCTGCTCAAAATCAGCCTCCGAACTTGAACTTTTGGTGAGGAAAACCTGCTCAATAACTGGCTCAGTCTGGAGCGCAGATTCACCTAAGTCTGAGTTG
TCAGTGGGAACCCGGCGCCACCCAAGTATTACATGTCCCAGCGATTCCGCTACCTGGATAAATGAAAGTAACAGAAAACATTAGTGTAAATATCACGGCC
ATGAATTGAAAAAACAAAAGAAATGAAAACAACTAACCTTCTGAAACTCAGCTTTGCTCCGCTCACGGCGCTTCTCATCGATTGGCAGGAAGACCATACC
GACAGCATACTCGCCTGGCTGCGGTAGCTCAAACCCAGCATCCTTTCTCGCCTCTCTGAAAAAGTTATGCGGTAGAGCCACAAGGATGCCGGCACCATCG
CCAGTGTTCTTCTCACAGCCGCAGGCACCACGGTGCGCCATTCTCTCAAGCATCTCGAGGGCGTCATTGACCT