Detailed information on CNT3099043


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONCQUT004405, E-value = 9e-130

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT3099043

Peptides detected in this lncRNA

>peptide 1 (44 aa)
MLSQLFVFHKSKNFTFDYEIRMPPTVYVNHYSDPEGQHNRTEIL*

>peptide 2 (56 aa)
NENILGKCFRSCSSFINPRISPLTMKYECPRLSMLIITPILKANIIGPKSYNVIPC*

Sequence

>CNT3099043
AATGAAAACATCCTTGGCAAATGCTTTCGCAGTTGTTCGTCTTTCATAAATCCAAGAATTTCACCTTTGACTATGAAATACGAATGCCCCCGACTGTCTA
TGTTAATCATTACTCCGATCCTGAAGGCCAACATAATAGGACCGAAATCCTATAATGTTATCCCATGCTAATGTATACAGAGCGTAGGCTTGCTTTGAGC
ACTCTAATTTCTTCAAAGTAACAGCGCCGGAGGCACGACCCGGCCAATTAAGGCCAGGAGCGCATC