Detailed information on CNT3098769


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONCQUT004405, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT3098769

Peptides detected in this lncRNA

>peptide 1 (37 aa)
MAHLELLIPWRGSTKQPRRPTYLKFENRSRALRPRGL*

Sequence

>CNT3098769
CGGGTGTAGGTCATGCGCTTAAGCGCCATCCATTTTCGGGGTTAGTTGATTCGGCAGGTGAGTTGTTACACACTCCTTAGCGGATTTCGACTTCCATGAC
CACCGTCCTGCTGTCTTAATCGACCAACACCCTTTGTGGGATCTAGGTTAGCGCGCAGTTTGGCACCGTAACCCGGCTTCCGGTTCATCCCGCATCGCCA
GTTCTGCTTACCAAAAATGGCCCACTTGGAGCTCTTGATTCCGTGGCGCGGCTCAACAAAGCAGCCGCGCCGTCCTACCTATTTAAAGTTTGAGAATAGG
TCGAGGGCGTTGCGCCCCCGAGGCCTCTAATCATTGGCTTTACCCGATAGAACTCGCACGCGAGCTCCAGCTATCCTGAGGGAAACTTCGGAGGGAACCA
GCTACTAGACGGTTCGATTAGTCTTTCGCCCCTATACCCAAGTCAGACGAACGATTTGCACGTCAGTATCGCTGCGGGCCTCCACCAGAGTTTCCTCTGG
CTTCGCCCCGCTCAGGCATAGTTCACCATCTTTCGGGTCCCGACAGGTATGCTCACACTCGAACCCTTCTCAGAAGATCATCGTCGGTCAGCGGTGCACC
CCTCAGAAGGATCCC