Detailed information on CNT3098290


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONSTUT001229, E-value = 1e-130

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT3098290

Peptides detected in this lncRNA

>peptide 1 (38 aa)
MVEEVISLVVVVRSNNMVEGETSLVVAENCNSTGEEVI*

>peptide 2 (35 aa)
HFWMLPIITSKTIDFANNFDHELMMWRIVVSWWWW*

Sequence

>CNT3098290
GACATTTCTGGATGCTTCCAATCATAACATCTAAAACAATAGACTTTGCCAACAACTTTGACCACGAATTGATGATGTGGAGGATAGTAGTGAGTTGGTG
GTGGTGGTGAAGTATAGTAGTATGGTGGGGGAGAAGACTTCTTTGGTGGTGGTGGTGGAGACTTATAGTAGTATGGAGTTGGAGGTGACTTAACTGGTGG
TGGTGGGGAACTGTAGTGATATGGTGGAGGAGGTGATTTCTTTGGTGGTGGTGGTGAGGAGTAGTAATATGGAGGAGGTGGTGACTTAACAGGTGGTGGT
GGAGAAGTGTAATGATATGGTGGAGGAGGTGATTTCTTTGGTGGTGGTGGTGAGGAGTAATAATATGGTGGAGGGGGAGACTTCACTGGTGGTGGCGGAG
AATTGTAATAGTACGGGGGAGGAGGTGATTTAGAAGGTGGTGGTGGAGACTTGTAATAGTATGGTGG