Detailed information on CNT3097808


BLAST search results

BLAST vs Swiss-Prot:
sp|Q9ZUH5|SDR2B_ARATH, E-value = 2e-33

BLAST vs NONCODE:
NONSTUT000961, E-value = 4e-145

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30511391Solanum tuberosumSolanum lycopersicum10033.4296.17366forward

Expression of CNT3097808

Peptides detected in this lncRNA

>peptide 1 (43 aa)
MTDPSAPSSTGIVPVCQFISVLTYPGWTQLIHIFGYFLARIRV*

>peptide 2 (36 aa)
MLYAGSIICQPFTSRASCFRSCKKICRILSILSSVRF

>peptide 3 (34 aa)
MLVASSANHSPRGHLVSDHAKKFAESCRFYLLSGF

>peptide 4 (32 aa)
MPVYIRVDVSRMDTIDTHFRVLSCKNSSVSIE*

Sequence

>CNT3097808
GTTTGGGACTGAGGAGTAGTTATTGCTATATCTAAAACTCATCGACTACAGTACGATCAAAGTAGCAACCAGTAGGTCCTCCATCAGGCAAAAGAGCTAG
CATGACAGATCCTTCAGCTCCTTCTTCGACAGGCATTGTTCCTGTATGCCAGTTTATATCCGTGTTGACGTATCCAGGATGGACACAATTGATACACATT
TTCGGGTACTTTCTTGCAAGAATTCGAGTGTAAGCATTGAGTGAGACTTTTGATATGCTATATGCTGGTAGCATCATCTGCCAACCATTCACCTCGAGGG
CATCTTGTTTCAGATCATGCAAAAAAATTTGCAGAATCTTGTCGATTTTATCTTCTGTCAGGTTTT