Detailed information on CNT3097571


BLAST search results

BLAST vs Swiss-Prot:
sp|Q9LRR4|R13L1_ARATH, E-value = 1e-49

BLAST vs NONCODE:
NONSTUT000981, E-value = 2e-21

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT3097571

Peptides detected in this lncRNA

>peptide 1 (82 aa)
IFQFVNRWQNYLHSTSKITSQHVPFPSYLPSQLPFYQPHFATLKLIEIHTSYVLHPNLPFSNHRYHLQETWLPLAFGDFSTC*

>peptide 2 (98 aa)
DLSVCESLAELPSLHFKDNFSTCSFSFIFAFTASLLSTTFCNSKTDRDPYKLCTSPKSSILKPPLPPTRNLAPTSIWRLFNLLRCSGIFKQQVLVMSR*

>peptide 3 (39 aa)
MLCNTLLLSREKKLILVRSNVLSFSNLESGFNFSKLPMSS

>peptide 4 (33 aa)
MESGNFSINVSERSKNLRSFNLINKSFGNSLLW*

>peptide 5 (29 aa)
MTGEVSPSYTMHKWNLVTFQSMFQKGPKI*

Sequence

>CNT3097571
GGATCTTTCAGTTTGTGAATCGTTGGCAGAACTACCTTCACTCCACTTCAAAGATAACTTCTCAACATGTTCCTTTTCCTTCATATTTGCCTTCACAGCT
TCCCTTCTATCAACCACATTTTGCAACTCTAAAACTGATAGAGATCCATACAAGTTATGTACTTCACCCAAATCTTCCATTCTCAAACCACCGCTACCAC
CTACAAGAAACTTGGCTCCCACTAGCATTTGGAGACTTTTCAACTTGCTAAGATGTAGCGGCATCTTCAAGCAACAAGTGTTGGTTATGTCGAGGTGACG
CAAGTTGATCAACTTCTCCATCTGCAGCGGTAGCTCCTTAAGATTTTTACAAGATGACAGGAGAAGTGTCTCCAAGTTATACAATGCACAAATGGAATCT
GGTAACTTTTCAATCAATGTTTCAGAAAGGTCCAAAAATCTGAGGAGCTTTAATTTGATAAACAAGTCATTTGGCAACTCCTTATTATGGTAATGAGACA
ATGATAATGCCCTTAAGGATGTCAGTCTTGGAAGTATGTTATGCAACACCCTCTTGCTTAGCAGAGAAAAGAAACTGATATTGGTTCGAAGCAATGTCCT
CAGCTTCTCTAATTTGGAGAGTGGTTTCAATTTCTCAAAGTTACCAATGTCGTCAGC