Detailed information on CNT3097337


BLAST search results

BLAST vs Swiss-Prot:
sp|P69325|UBIQP_SOYBN, E-value = 0.0

BLAST vs NONCODE:
NONMEST001181, E-value = 3e-173

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30516063Solanum tuberosumJuglans regia80.9793.0282.05919forward
CNT30156103Solanum tuberosumPistacia vera83.7980.3283.18951forward

Expression of CNT3097337

Peptides detected in this lncRNA

>peptide 1 (37 aa)
QVNRLVHERNIATNRPKTPTATDSIKNHHRIGGQGAE*

>peptide 2 (31 aa)
MVSELSTSRVIVLPVKVFTKICIPPRRRRTK*

>peptide 3 (31 aa)
MVSELSTSRVIVLPVKVFTKICIPPRRRRTK*

>peptide 4 (31 aa)
MVSELSTSKVMVFPVKVFTKICIPPLSLNTR*

>peptide 5 (37 aa)
MVSELSTSRVIVFPVRVLTKICIPPRRRSTKWRVDSF*

>peptide 6 (29 aa)
MSFHLPIACQQKSTFADLVGYPLCPESLP*

Sequence

>CNT3097337
ACAAGTAAACAGACTAGTTCATGAACGAAACATAGCAACAAACAGACCCAAGACACCAACAGCAACAGACTCCATCAAAAACCACCACAGAATCGGAGGA
CAAGGTGCAGAGTAGACTCCTTTTGGATGTTGTAGTCCGCCAGAGTCCTTCCATCTTCAAGCTGCTTCCCTGCAAAGATCAGCCTCTGCTGGTCCGGTGG
GATTCCCTCCTTGTCCTGAATCTTAGCCTTCACATTGTCAATGGTATCAGAACTCTCCACCTCCAAAGTGATGGTTTTCCCAGTCAAGGTCTTCACAAAA
ATCTGCATACCTCCCCTGAGCCTCAACACAAGATGAAGGGTCGATTCCTTCTGAATATTGTAATCGGCTAATGTCCTTCCATCTTCCAATTGCTTGCCAG
CAAAAATCAACCTTTGCTGATCTGGTGGGATACCCTCTTTGTCCTGAATCTTTGCCTTAACGTTGTCAATGGTGTCGGAGCTTTCCACCTCAAGGGTAAT
AGTCTTGCCAGTCAAGGTCTTCACGAAGATTTGCATCCCACCACGGAGACGCAGGACCAAGTGAAGGGTTGACTCCTTCTGGATGTTGTAATCAGCAAGG
GTCCGGCCGTCCTCAAGCTGCTTTCCGGCAAAGATCAACCTCTGCTGGTCTGGTGGAATACCTTCTTTGTCCTGAATTTTGGCCTTAACATTGTCAATGG
TGTCAGAACTTTCCACCTCAAGGGTAATAGTCTTGCCAGTCAAGGTCTTCACAAAGATTTGCATCCCACCGCGAAGACGAAGGACCAAGTGAAGGGTTGA
CTCCTTCTGGATGTTGTAATCAGCAAGGGTCCGGCCATCCTCAAGCTGCTTTCCGGCAAAGATCAATCTTTGCTGGTCTGGGGGAATGCCTTCCTTGTCC
TGGATCTTGGCTTTAACCCTTAACGTTGTCAATGGTGTCTGAGCTTTCCACCTCGAGGGTGATTGTCTTTCCAGTGAGGGTTTTGACAAAGATCTGCATC
CCACCACGAAGACGGAGCACCAAGTGGAGAGTTGACTCCTTCTGAATATTGTAATCGGCTAGAGTACGGCCGTCTTCAAGCTGCTTGCCTGCAAAGATCA
GCCTCTGCTGGTCCGGGGGAATGCCTTCCTTGTCC