Detailed information on CNT3097291


BLAST search results

BLAST vs Swiss-Prot:
sp|P0CG85|UBI1P_NICSY, E-value = 0.0

BLAST vs NONCODE:
NONMEST001181, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30641270Solanum tuberosumNymphaea colorata72.1455.63821111forward
CNT30532384Solanum tuberosumEucalyptus grandis88.992.4482.11369forward
CNT30500417Solanum tuberosumCoffea canephora74.2256.7581.631143forward
CNT30272593Solanum tuberosumChenopodium quinoa89.3557.1783.721376forward
CNT3020365Solanum tuberosumCitrullus lanatus56.9550.2382.44877forward
CNT30401729Solanum tuberosumBeta vulgaris73.4482.5580.461131forward
CNT30525141Solanum tuberosumPhaseolus vulgaris85.7176.2681.821320forward
CNT30637282Solanum tuberosumCapsicum annuum92.9272.6894.061431forward
CNT30538027Solanum tuberosumBrassica napus88.972.280.861369forward
CNT30145352Solanum tuberosumMedicago truncatula89.4869.2582.371378forward
CNT30311152Solanum tuberosumCamelina sativa88.984.8781.231369forward
CNT3061767Solanum tuberosumArabidopsis lyrata57.2153.9583.54881forward
CNT30460578Solanum tuberosumSaccharum spontaneum69.4253.4282.041069forward
CNT30626099Solanum tuberosumDaucus carota73.9636.4983.581139forward
CNT30480747Solanum tuberosumArabidopsis halleri58.1277.1682.35895forward
CNT30418420Solanum tuberosumPapaver somniferum73.9666.2682.881139forward
CNT30642231Solanum tuberosumCannabis sativa59.4886.4282.75916forward
CNT3028051Solanum tuberosumTheobroma cacao73.993.3682.341138forward
CNT30330420Solanum tuberosumDioscorea rotundata5550.0682.17847forward
CNT30334105Solanum tuberosumCynara cardunculus88.958.0681.31369forward

Expression of CNT3097291

Peptides detected in this lncRNA

>peptide 1 (40 aa)
MVSELSTSKVIVFPVSVLTKICIPPLKRSTKWSVDSFWIL*

>peptide 2 (55 aa)
MSSQKSAYHPLGAAPNGELIPFECCNLLESFHPQAVSQQKSTSAGQVGCLPYLEF*

>peptide 3 (57 aa)
MSSQKSAYHLADEGQGGGWTPSEYCSQQEYDHPQVAFQQKSTFAGLEECPPCPEFLP*

>peptide 4 (59 aa)
NRAKFLFIHINDSSTTHKKGNITKLKPEKSGKHLSTKGEENTVTKAINSQKPPRRRRTR*

>peptide 5 (37 aa)
MVSELSTSRVIVFPVNVFTKICIPPLRRSTKWRVDSF*

>peptide 6 (37 aa)
MVSELSTSRVMVFPVNVFTKICIPPRRRRTRWRVDSF*

Sequence

>CNT3097291
GTAACAGAGCTAAATTTTTATTTATTCACATAAACGACAGTTCAACCACACATAAGAAAGGCAACATCACAAAACTAAAACCAGAAAAGTCTGGAAAACA
TCTTTCGACCAAAGGAGAAGAAAACACAGTTACAAAAGCAATAAATTCTCAAAAGCCACCACGGAGACGAAGAACAAGGTGAAGAGTTGACTCTTTCTGA
ATGTTATAGTCAGCAAGGGTGCGACCATCCTCCAGCTGCTTACCAGCAAAAATCAACCTCTGCTGGTCTGGTGGGATACCCTCCTTATCCTGAATCTTCG
CCTTCACATTATCAATGGTATCTGAGCTCTCCACCTCCAAGGTAATCGTCTTTCCAGTAAGTGTCTTGACAAAGATCTGCATTCCTCCTCTCAAACGGAG
CACCAAATGGAGTGTGGACTCTTTCTGGATATTGTAATCAGCAAGAGTCCTACCATCCTCAAGCTGCTTGCCAGCAAAAATTAAACGCTGCTGGTCTGGT
GGAATCCCTTCTTTGTCTTGGATCTTTGCCTTCACATTATCAATGGTGTCTGAACTTTCTACCTCCAGGGTGATTGTCTTCCCAGTCAATGTCTTCACAA
AAATCTGCATACCACCCCTTAGGCGCAGCACCAAATGGAGAGTTGATTCCTTTTGAATGTTGTAATCTGCTAGAGTCCTTCCATCCTCAAGCTGTTTCCC
AGCAAAAATCAACCTCTGCTGGTCAGGTGGGATGCCTTCCTTATCTTGAATTTTAGCCTTGACATTGTCGATGGTGTCAGAACTCTCAACCTCAAGGGTG
ATGGTCTTCCCTGTCAATGTCTTCACAAAAATCTGCATACCACCTCGCAGACGAAGGACAAGGTGGAGGGTGGACTCCTTCTGAATATTGTAGTCAGCAA
GAGTACGACCATCCTCAAGTTGCTTTCCAGCAAAAATCAACCTTTGCTGGTCTGGAGGAATGCCCTCCTTGTCCTGAATTTTTGCCTTAACATTGTCAAT
AGTGTCTGAGCTTTCAACCTCGAGGGTAATAGTCTTTCCAGTCAAGGTTTTCACAAAGATCTGCATGCCACCACGCAGACGAAGGACAAGGTGGAGTGTG
GACTCCTTTTGGATGTTGTAGTCAGCTAGAGTTCTTCCATCCTCCAACTGTTTACCGGCAAAGATCAATCTCTGCTGATCTGGAGGAATTCCTTCCTTAT
CTTGGATTTTTGCCTTGACATTGTCAATAGTGTCAGAGCTCTCAACCTCAAGAGTAATTGTCTTCCCAGTCAAGGTTTTCACAAAGATCTGCATACCACC
ACGCAAACGAAGGACAAGGTGGAGGGTGGACTCCTTCTGGATGTTATAGTCTGCAAGAGTTCTACCGTCCTCTAATTGCTTTCCAGCAAAGATCAGCCTT
TGCTGATCAGGAGGAATTCCTTCCTTGTCTTGAATCTTTGCCTTAACATTATCGATTGTGTCAGAACTCTCAACCTCGAGAGTTATGGTCTTGCCAGTAA
GGGTCTTAACAAAGATTTGCATCTATAATTAATCAAAAAG