Detailed information on CNT3096979


BLAST search results

BLAST vs Swiss-Prot:
sp|Q7XA39|RGA4_SOLBU, E-value = 3e-24

BLAST vs NONCODE:
NONSTUT000776, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT3096979

Peptides detected in this lncRNA

>peptide 1 (30 aa)
MLLDPILLISTPYKAGPMHSNSWNPTSSRC*

Sequence

>CNT3096979
ACACTAAGCTTTACGAGAGATGTCAAGTTGCTGCACAAGTTCAACAATGGCATTTCACTGTCAACTCCTCTAATTTCTAATTGACGGAGGATTTCAAATT
GATTCGGAATACTTTTTAACAATGGACAGTCTGTAATCCGCAACTTCTCAAGCCTGGGAGACATTCTTACTCCAACTTCATCTCCCTTCCACTCAATAAG
GCTACGCATATCCTCCAATACTAGTTCTTTCAATGACGGGAACACTTGGATAATGCTGCTTGATCCAATATTGCTAATCTCAACACCATATAAAGCAGGT
CCAATGCATTCCAACTCATGGAATCCTACCAGCTCAAGATGCTGAAGGACTTTCAGTTGGCCAAGGGATGGAATTTCTTTGCACCTTTTGCTACCACTTA
ATTTCAACTTGACCAAATTTGGTAGCGACTCTTCACTGAACCATGAAGGAAATTTAGTCCCTAAATAGCCCACTACTGCTAAGGTTTTCAAGTTAGGATG
CGGTTGAAGACCATCCAACACATACTCATCATTGATCTCACACCCTTCTGATTCATCATGGGTCCATAAATATGCCAGCTTGCAGATATTTGGTTTCTCC
TGTAAATATGTTGTTCGAGCCTCTTCTTTATCACAGATCAATTGGAGACCATTGATCGTCAATTCACCTCTTAGGTTTTTCAAATGACCTAATTCTTCTA
TTTGACGA