Detailed information on CNT3096895


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONSTUT000757, E-value = 6e-178

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30511364Solanum tuberosumSolanum lycopersicum14.0444.4288.58219forward

Expression of CNT3096895

Peptides detected in this lncRNA

>peptide 1 (46 aa)
MLFYIDLQAAEANTTFRLPISFKNLENLDFSSKKVCWRTINFQIFV*

>peptide 2 (34 aa)
MSLPLIFWFKKVLAINTFTINAFLNLSIDGKSIF*

Sequence

>CNT3096895
ATCACACTCTCTATTTTCTTCTCCCTAAAACAAAGGCGTAAGTTTTGGGGGAAATAAAATAGATAAGCAAAATATAAAATAAAAATCAAGAAATCAAAAG
TGGAGATTTTTTTATTTGTGGGGAATGTTGTCTGGCTCGAGGAAATCTTCAATCCTGATCAATTTTTTTTTATACATATTTTTATAGTAATTACTATATT
GTTACATAGATCTATACAATATTTATGATAGATCTATGAATTTTTGATTATATTGTTGGGTGTCGTCGGACCAGGCTTCATTCCCCTCAAAGATTATATC
TACCACATAATTAATTTCAGATCTTTACAAGAGTATCTGGACACTAGCTACTTCTAGCCACATTGTATAGGAAAAAGTACTAGCTGGAGTAATTTTATTT
TGGTTTGAATATTGTTTAATATTTGGTGATTGTTCTTTTTATACTAATATTTTTTAATTTTTTTTGTGCAAATAGGACTAGGTTTGATTGTTCTTGTTGC
TATTAGATTTGAGTCCTTAATGAATACCTAAGAGTAATGTTGTTTTATATAGACCTGCAGGCTGCAGAAGCTAACACCACCTTTAGGTTACCCATATCGT
TTAAGAATTTAGAAAACTTAGATTTCTCAAGTAAAAAAGTATGCTGGAGAACCATAAATTTTCAAATATTTGTGTGATTATAAAATTTAATCGCTTTTTT
TGAAAATTTGTTCTATAAATATTTTCAAATTTTCAAAAATTGGTTTAGAACAATTTTTGGGTTATTTGGACTTTCACTCACAATACTTTAATATTTTTCA
ATCAAATGTGTGTTCAAATTTCAAGTTTTCACTTTAAATTCATGATTTTAAAAAAATAATAATTTCCTAGTGATCCTGGGAGTGTTGCATTTCATTCCAT
ATAAAGATTTAAATTACAAAACAAAGGATAGAGATTAATTAAAATGTCATCCGTTTATAGTTTGGCTTAAAAAATGTCATTGCCGTTAATATTTTGGTTC
AAAAAGGTCCTTGCAATCAATACTTTCACTATAAATGCATTTTTGAACTTAAGTATTGACGGTAAAAGTATTTTTTAGCCAATTTATTAACGGAGGACAT
TTTTATTCATTTCACATAGCTTAAGAGCATTTTTTTTATAACCATTTTCTCTAAAGAAAAATTGTTTTGTTAAATTTCGATTTAATATTTGATCTCTATC
CATGAGAAAAGGACCATTTGCATCCTTAGAAAGTTGTTGGGATCTATTGTCAAATGGAATCTTATAGTGATAGACTCACTGTTAAATCATCTGTTGCTTC
AGTTTCAATTTATGTAGCTAAATTTGAATAGACAAGATTTTTTTCTTATTTTTTATAAAAGATTACTTTTCAAATTTGTGGTTAATAATGTTTTATTTTA
TTTGTGTAGGTATAAGATTTTTGAAATTTGATATTAAGCATCCGTAGCATTTATTTAGTACTGTCTTCTTTCCATTTTAATGGTCATTTTAGCACTTTTC
ATATTTAATAAAAAAATAAAATAAATATAAGCCGGTATATATAGTTTACTAAGTTACCTC