Detailed information on CNT3096745


BLAST search results

BLAST vs Swiss-Prot:
sp|P0CG85|UBI1P_NICSY, E-value = 0.0

BLAST vs NONCODE:
NONMEST001181, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30568725Solanum tuberosumActinidia chinensis73.4394.5781.131097forward

Expression of CNT3096745

Peptides detected in this lncRNA

>peptide 1 (59 aa)
NRAKFLFIHINDSSTTHKKGNITKLKPEKSGKHLSTKGEENTVTKAINSQKPPRRRRTR*

>peptide 2 (57 aa)
MSSQKSAYHLADEGQGGGWTPSEYCSQQEYDHPQVAFQQKSTFAGLEECPPCPEFLP*

>peptide 3 (55 aa)
MSSQKSAYHPLGAAPNGELIPFECCNLLESFHPQAVSQQKSTSAGQVGCLPYLEF*

>peptide 4 (37 aa)
MVSELSTSRVIVFPVNVFTKICIPPLRRSTKWRVDSF*

>peptide 5 (37 aa)
MVSELSTSRVMVFPVNVFTKICIPPRRRRTRWRVDSF*

Sequence

>CNT3096745
GTAACAGAGCTAAATTTTTATTTATTCACATAAACGACAGTTCAACCACACATAAGAAAGGCAACATCACAAAACTAAAACCAGAAAAGTCTGGAAAACA
TCTTTCGACCAAAGGAGAAGAAAACACAGTTACAAAAGCAATAAATTCTCAAAAGCCACCACGGAGACGAAGAACAAGGTAATCGTCTTTCCAGTAAGTG
TCTTGACAAAGATCTGCATTCCTCCTCTCAAACGGAGCACCAAATGGAGTGTGGACTCTTTCTGGATATTGTAATCAGCAAGAGTCCTACCATCCTCAAG
CTGCTTGCCAGCAAAAATTAAACGCTGCTGGTCTGGTGGAATCCCTTCTTTGTCTTGGATCTTTGCCTTCACATTATCAATGGTGTCTGAACTTTCTACC
TCCAGGGTGATTGTCTTCCCAGTCAATGTCTTCACAAAAATCTGCATACCACCCCTTAGGCGCAGCACCAAATGGAGAGTTGATTCCTTTTGAATGTTGT
AATCTGCTAGAGTCCTTCCATCCTCAAGCTGTTTCCCAGCAAAAATCAACCTCTGCTGGTCAGGTGGGATGCCTTCCTTATCTTGAATTTTAGCCTTGAC
ATTGTCGATGGTGTCAGAACTCTCAACCTCAAGGGTGATGGTCTTCCCTGTCAATGTCTTCACAAAAATCTGCATACCACCTCGCAGACGAAGGACAAGG
TGGAGGGTGGACTCCTTCTGAATATTGTAGTCAGCAAGAGTACGACCATCCTCAAGTTGCTTTCCAGCAAAAATCAACCTTTGCTGGTCTGGAGGAATGC
CCTCCTTGTCCTGAATTTTTGCCTTAACATTGTCAATAGTGTCTGAGCTTTCAACCTCGAGGGTAATAGTCTTTCCAGTCAAGGTTTTCACAAAGATCTG
CATGCCACCACGCAGACGAAGGACAAGGTGGAGTGTGGACTCCTTTTGGATGTTGTAGTCAGCTAGAGTTCTTCCATCCTCCAACTGTTTACCGGCAAAG
ATCAATCTCTGCTGATCTGGAGGAATTCCTTCCTTATCTTGGATTTTTGCCTTGACATTGTCAATAGTGTCAGAGCTCTCAACCTCAAGAGTAATTGTCT
TCCCAGTCAAGGTTTTCACAAAGATCTGCATGCCACCACGCAGACGAAGGACAAGGTGGAGGGTGGACTCCTTCTGGATGTTATAGTCTGCAAGAGTTCT
ACCGTCCTCTAATTGCTTTCCAGCAAAGATCAGCCTTTGCTGATCAGGAGGAATTCCTTCCTTGTCTTGAATCTTTGCCTTAACATTATCGATTGTGTCA
GAACTCTCAACCTCGAGAGTTATGGTCTTGCCAGTAAGGGTCTTAACAAAGATTTGCATCTATAATTAATCAAAAAGAGAAGTCATTAGACAAAACGGAA
AAACTAATAATCCAAAACATAGGTGAAGGAAATCAAAAGAAAACAAATAAGAATCCATAATATGAACTAATTCCATATTACATGGATGCAGATG