Detailed information on CNT3096532


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT3096532

Peptides detected in this lncRNA

>peptide 1 (31 aa)
KYHYCKYSCIVGVYKFTILLIMDKVGHIFFY*

>peptide 2 (34 aa)
MRRSIFSSNDSSSCLRAPSFSVFSSWTLARTFSL*

Sequence

>CNT3096532
AAAAATATCATTATTGTAAATATTCTTGTATCGTTGGTGTATATAAATTCACAATACTACTAATAATGGATAAAGTTGGACATATTTTTTTCTACTAGAA
ACTAGACATATGTAAGACACTTTGTCACATCAAATCAAAAACTCTATTCCCATCCCCACCCAGCAAGAAAATATAGTCCATCATTACGAGCACAACAACA
TGAAATTACTCCAATTATAGTGCCTCCATTTGACGTATGAGACGCTCGATATTTTCTTCGAATGATTCCAGTTCTTGCTTGAGGGCACCAAGTTTCAGTG
TATTTTCTTCATGGACATTAGCACGAACTTTCTCTTTGTAGCCAGAGGTACTCATGGTTTTGGTTAAGGTTTCATATTG