Detailed information on CNT3094920


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30635875Solanum tuberosumCapsicum annuum4.1520.187.07116reverse complement

Expression of CNT3094920

Peptides detected in this lncRNA

>peptide 1 (60 aa)
MWCMHRQDMGQIYLKCPISISLGGTKDLQNHHCLFQAINYTHHHLHNLSQRRIQDKVNAF*

>peptide 2 (80 aa)
MLYSSALRICWRPPKIGFQQEKKQKSLIDYKVPIKSKICAASSILTEETRKIAIHGFIYFHYQKQHKQLVLRQNFLKSIN*

>peptide 3 (47 aa)
MFESRFNVASSVCTDLFWSSIFVKRSVPKFSDQFKKTSKRYCFSDQT*

>peptide 4 (54 aa)
MAANIGCLVRRDYKKPTISHPSSQTFQVVFAKPGLGLDSNIFSLIKIIFIASVF*

>peptide 5 (38 aa)
MTLDIVVMNCITLFFHMRWKSKLHRQKIIHQLSYQNFP*

>peptide 6 (41 aa)
MLETSKNWFPTREKTKKPNRLQSAYKIQNLCSFFYFNRRDP*

>peptide 7 (29 aa)
MAAKNSMPRQDTDRITSNAQLISSKGNKK*

>peptide 8 (29 aa)
MAAKTNRKCGACTAKIWVKFISNARLVLA*

Sequence

>CNT3094920
TCCCTTCTGAGCTTTTTTGTTGAGAAGAGAGAGAGAGACAAATAAGACTCAAGTTCAGAATGCAGGAAATGACAAAAATAGTCCCTTATGTTTGAGAGTA
GGTTCAACGTAGCCTCTTCAGTATGCACTGACCTGTTTTGGTCTTCTATATTTGTCAAGAGATCAGTACCTAAATTTTCAGATCAATTCAAGAAAACTTC
TAAAAGATACTGTTTCAGTGATCAAACGTAAGTTAAATTGAGGTAAGGAGGCTCAGACTTTCGCCTATTTAATCAAAGAGCAGAGCTAAACCAGCCATGG
CTGCAAATATTGGTTGCCTCGTGAGAAGGGACTACAAGAAACCTACTATTTCTCATCCTTCTTCACAGACCTTCCAAGTTGTCTTTGCCAAGCCAGGACT
TGGACTTGACTCCAACATTTTCAGTCTTATAAAGATAATCTTCATAGCCTCCGTATTTTAGGATTCTCAAGATACAGAAAAGGGCTTCAAATTTGAGGAT
GAACACGTGACACTTCAATTGAAAGACAGATAAAAGCATGTCATGTTAGTACCCTTACACAGCCAAAGCAACTGCTCAAAGGCCATTTTTCTGACAAATA
ATTAAATAGTACAAAGAGCACAAAACCTTCTGAGTTAAATCTTGCCTTAATTGGCAAAGATAATCTCTTCTCCAGTCAACACTCTACTGCTTTGACTCAT
TCCTGCAGAGTTCAAAGACTTATTTTTCAAGACAATACAGATAAATGTTGCAGGTTTAATCAAGGTACACATAAATATACTTTTCTAGCAATAGCATGAG
CTTGCCACTTTTGTTTGTTTTTTTTCTTTTTTGATACAGATAATGTTGTATTCATCAGCATTAAGGATATGCTGGAGACCTCCAAAAATTGGTTTCCAAC
AAGAGAAAAAACAAAAAAGCCTAATAGATTACAAAGTGCCTATAAAATCCAAAATTTGTGCAGCTTCTTCTATTTTAACAGAAGAGACCCGTAAAATTGC
AATTCATGGATTCATATACTTCCATTATCAAAAACAACATAAGCAACTAGTCTTACGGCAGAATTTTCTAAAATCAATAAATTGAGGTTCAGATCTGTGT
TTACCTCTGGCAGAAAGAGAGTTCAACGACACCATGGCTGCAAAAACCAACAGAAAATGTGGTGCATGCACCGCCAAGATATGGGTCAAATTTATCTCAA
ATGCCCGATTAGTATTAGCTTAGGAGGGACGAAAGATTTACAAAATCATCATTGCCTCTTTCAAGCCATCAATTATACTCATCACCACCTGCATAACTTG
TCTCAAAGGCGGATCCAGGATAAAGTTAATGCATTCTAGACAATAACTTTTCTCCGGAGGTGAATCCAGGACTTTGTTTATTGGGCTATTGATAGATTAT
TACACATATTAGCTGAAGTTCTTAAAACAAATACAGGGTTTTGGCCTAGGTTTTACTGAATTGATAGCTTCCAAAACGACAGAGAAAGTACAACAACATA
CCCAGTGTAATACCACAAGTGGGTTGGGGGAGGGTAGAGTGTACATAGACCTTACCCCTACTTTGTAGAAATAGAGAGGTTGTTTCCAATAGACTCTTGG
CTAAGTAACGCATCTCAAAGCAGCCTAGCAACACCATGGCAGAGAGAAAGTGAGGCTCAGATATGTGTTAAGCTCGAGCAAAAAGAGAGTCCAACCACGC
CATGGCTGCAAAAAACAGTATGCCCCGCCAAGATACAGATCGGATAACCTCAAATGCTCAATTAATCAGCTCAAAAGGGAATAAAAAGTGACAAAAATCA
TCATCGCCTCTATAAAGACACCAATTATACTCACCCCCACCAGCAACACTGAATGCTCAGGCAGAAGTATAAAGAAAAAATAAAGAGAAAAAGAGTTGAA
AGGTCATAGAAACCCATTTCAAACAAAGCTGATAATTATATATTCCCTCTGTTCAAAATTGATAAAAGGGTTGTTGGAATTCTTACATTAATGGAGAAAT
CATCGGCTGATGTAGAGAGTGGCAACCACCATTCCAATGAGAAATCCTTAAACTCTCTTTAAGCCTCATTCTTTCCCTTTTGAGCTTTTTGCTTTGTCCA
TTTCCCTTAGGTTTTGCTTATATAGTCCCCTCAACACTTGAACTATAATACTCCCATCTTTTTACCAGTTCATTAATTTTTCTTGTTGAAAGTATTAAAA
AAACAATTTCTTTAGAACAAAGATTTACATTTACAATTTTTAGATTTTTTTAAAATATAGTTTCCAAATTTTCTTGGTCGAGATAGTTTGAATATGTAAA
AATGAGATGTACTAGTGTTCCAATGCAAAGGTACAAGGATATTGTGGATAGGTGATAAGACATGATGCACTAACTTCACAAAGATATGACCTTGGATATA
GTAGTTATGAACTGTATCACTTTATTCTTTCATATGAGGTGGAAATCAAAATTACACCGACAAAAGATAATCCATCAACTGAGCTACCAAAATTTTCCAT
GAAGTTTCTTGTTGTTCCATCCCTTTCAGTATTATTTAATATTTCTTGCACATCAATCATTGTATAATTTTGATAGTGATTGTTCCTTTTTTAGTTTGTC
ATATTACTCCCTCCGTCCCTATTTACTTGTCCATATTTCCTTTTTTGGTTGTCCCTATTTAGTTGTCCATTTTGACAAATCAAGAAAGGACAACAAATTT
TTTCCTATTATACCCTTATTTACACTTCTTGAAAATTGTAAAAGTGTATGTTGTTTCCCTCCAATTTATTTCACTTGAATTCAAATAAGTGGTTGTAA