Detailed information on CNT3094664


BLAST search results

BLAST vs Swiss-Prot:
sp|Q42962|PGKY_TOBAC, E-value = 8e-60

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30371825Solanum tuberosumArabidopsis thaliana54.7844.1684.66189forward
CNT30504047Solanum tuberosumNicotiana attenuata75.3610096.15260forward
CNT30176931Solanum tuberosumSecale cereale37.3927.2285.27129forward
CNT3081642Solanum tuberosumBrassica juncea53.9151.3881.72186forward
CNT3011502Solanum tuberosumZea mays36.2321.483.2125forward
CNT30359398Solanum tuberosumLactuca sativa44.3528.7687.58153forward
CNT30604156Solanum tuberosumOryza punctata54.4933.3982.45188forward
CNT30557143Solanum tuberosumPanicum hallii37.3917.2984.5129forward

Expression of CNT3094664

Peptides detected in this lncRNA

>peptide 1 (34 aa)
MRVVPCCSHQQQTCPQSLHLWEAIEIPLLSLPSP*

Sequence

>CNT3094664
TGACCTAGTAAAACATTTATACAGATGAGGGTTGTACCTTGCTGTTCGCATCAGCAGCAAACTTGTCCGCAATCACTACATCTGTGGGAAGCAATAGAGA
TACCCCTTTTGTCTTTGCCTTCTCCATGAGAGATGTTGCCAAGTCAAGCTTGTCCTCCTCCACTAGTGATGATCCAACAGCGTATCCTTGGGCCTTGTAG
AAAGTAAAGATCATTCCTCCACCCAAAAGCAATATATCACATTTCTCCAGAAGTGATTCAATCACTCCAATCTTGGATGAAACCTTTGAACCACCCACAA
TAGCAGCAAATGGCCTCTTTGGAGTTGAAACTGCCCCAACTAAAT