Detailed information on CNT309444


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30519961Zea maysSetaria italica33.6840.6988.37129forward

Expression of CNT309444

Peptides detected in this lncRNA

>peptide 1 (67 aa)
MRRPRLGPAAAAIVRLSRANVSAAEHGTEEGGRGRRRRGGRIGDRRYPPISLWVGGCDAARGPPNFYP

>peptide 2 (42 aa)
MGRRKEGGEGVAAAGGLGIDAILLSLCGWEAVTLHAGPQTSIQ

>peptide 3 (45 aa)
LLGGVGSSASATATDPSATSSSDSAEVVTGSGSPASALASARGIM*

Sequence

>CNT309444
TTGCTCGGCGGCGTCGGTTCCTCCGCCTCCGCCACAGCGACAGACCCCTCGGCCACCTCCTCTTCGGATTCAGCTGAAGTAGTGACAGGCTCCGGTTCTC
CAGCTTCGGCACTTGCATCAGCGCGGGGGATTATGTGAGTGATTCGGCGATGGGAAGCGCACAAGGAGAGCCGGTGGAATGAGGAGGCCACGGCTAGGAC
CTGCGGCGGCGGCCATCGTAAGGTTAAGTCGGGCCAACGTGTCAGCGGCGGAGCATGGGACGGAGGAAGGAGGGAGGGGAAGGCGTCGCCGCGGCGGGAG
GATTGGGGATAGACGCTATCCTCCTATCTCTTTGTGGGTGGGAGGCTGTGACGCTGCACGCGGGCCCCCAAACTTCTATCCAG