Detailed information on CNT309286


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30671102Zea maysSetaria viridis43.456.3483.75240forward
CNT30520174Zea maysSetaria italica46.2923.9394.92256forward
CNT30303851Zea maysTriticum aestivum20.4339.3791.15113forward
CNT30666936Zea maysTriticum dicoccoides45.2120.3688.8250forward
CNT30139438Zea maysLolium perenne45.2120.5188.4250forward
CNT30686790Zea maysTriticum urartu29.6630.0490.24164forward
CNT30720370Zea maysTriticum spelta46.1121.785.88255forward
CNT30341843Zea maysEragrostis tef29.1119.481.99161reverse complement
CNT30364190Zea maysSorghum bicolor55.5232.0190.88307forward
CNT30150243Zea maysBrachypodium distachyon21.737.2792.5120forward
CNT30100439Zea maysOryza rufipogon45.2130.1986.8250forward

Expression of CNT309286

Peptides detected in this lncRNA

>peptide 1 (64 aa)
SWHGIDTNIVQHTQYCVNLSVSTVQNFLRVAIIISPIAQLKQFKQQGQWGAGRFHNHNNKVNLV*

>peptide 2 (50 aa)
MAMSVACPCAPPEGWWIMTLALGSARLSPGAPAARRSEPMEAAWPMQRVVT

>peptide 3 (37 aa)
MRKDFTFEANPHTAEGSSTSLSMHCSILSMGWRVCFW*

Sequence

>CNT309286
TCCTGGCATGGAATTGATACAAATATAGTACAACATACACAATACTGTGTCAATTTATCAGTATCAACAGTGCAGAATTTCCTTAGAGTTGCAATAATTA
TATCCCCAATAGCTCAATTGAAGCAATTTAAGCAACAAGGACAATGGGGAGCCGGACGTTTCCATAACCATAATAACAAGGTTAACCTTGTATAGTAAGA
ATTGAACCTTTGGATCTAACAACAAACAACACATCCACCGGATGAGGAAGGATTTCACCTTTGAGGCCAATCCTCACACCGCGGAAGGTTCCTCGACGTC
CCTCTCCATGCACTGCTCAATCTTATCGATGGGCTGGCGCGTGTGCTTCTGGTAGATCTTGTTGAGGCGGTCGCGCATTTTGAGGATCTCCTTGGCCTGG
ATGGCGATGTCGGTGGCTTGCCCCTGCGCGCCGCCCGAGGGCTGGTGGATCATGACCCTGGCGTTGGGAAGCGCGCGCCTCTCACCCGGCGCCCCAGCCG
CGAGGAGGAGCGAGCCCATGGAGGCCGCCTGGCCGATGCAGAGGGTGGTGACG