Detailed information on CNT3092080


BLAST search results

BLAST vs Swiss-Prot:
sp|P93276|M030_ARATH, E-value = 4e-38

BLAST vs NONCODE:
NONTPRT002187, E-value = 7e-154

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30677703Solanum tuberosumSetaria viridis35.5157.8296.14207forward
CNT30641383Solanum tuberosumNymphaea colorata43.748.1696.86255forward
CNT30550219Solanum tuberosumIpomoea triloba57.87.76100337forward
CNT30618996Solanum tuberosumSesamum indicum58.157.1396.46339forward
CNT30730372Solanum tuberosumCorchorus capsularis57.1217.2196.4333forward
CNT30490123Solanum tuberosumOlea europaea58.1519.4796.76339forward
CNT30505422Solanum tuberosumNicotiana attenuata58.4912.81100341forward
CNT30712870Solanum tuberosumGlycine max57.4620.1696.42335forward
CNT3046714Solanum tuberosumPrunus dulcis36.0298.5990.48210reverse complement
CNT30157603Solanum tuberosumPistacia vera47.3428.9394.93276forward
CNT30299883Solanum tuberosumTriticum aestivum48.0313.394.64280forward
CNT30223394Solanum tuberosumHordeum vulgare47.8624.293.91279forward
CNT30543270Solanum tuberosumBrassica napus47.3411.5297.46276forward
CNT30508435Solanum tuberosumSolanum lycopersicum21.276.4586.29124reverse complement
CNT30147386Solanum tuberosumMedicago truncatula58.1521.9894.99339forward
CNT30435868Solanum tuberosumAegilops tauschii48.0320.0995280forward
CNT30242786Solanum tuberosumAvena sativa48.232.4593.95281forward
CNT30661249Solanum tuberosumTriticum dicoccoides48.0345.3195280forward
CNT30605266Solanum tuberosumGossypium raimondii57.2915.9697.9334forward
CNT30207637Solanum tuberosumHelianthus annuus57.6317.1895.24336forward
CNT30688988Solanum tuberosumTriticum urartu48.0314.495280forward
CNT30721940Solanum tuberosumTriticum spelta48.0324.1895280forward
CNT30364089Solanum tuberosumSorghum bicolor30.8739.6593.33180forward
CNT30595740Solanum tuberosumOryza meridionalis23.3352.9297.06136reverse complement
CNT30359520Solanum tuberosumLactuca sativa57.6313.296.73336reverse complement
CNT3057903Solanum tuberosumAmborella trichopoda4711.4495.99274reverse complement
CNT30108930Solanum tuberosumOryza longistaminata48.0311.9795280forward
CNT3038420Solanum tuberosumCucumis melo44.7718.2898.08261forward
CNT30331546Solanum tuberosumDioscorea rotundata44.7762.5993.1261reverse complement
CNT30113381Solanum tuberosumFicus carica44.0857.6296.89257reverse complement
CNT30335929Solanum tuberosumCynara cardunculus13.0420.697.3776forward
CNT30725732Solanum tuberosumLupinus angustifolius36.3647.0198.58212forward

Expression of CNT3092080

Peptides detected in this lncRNA

>peptide 1 (43 aa)
KRMHWMDARALRRKDAFRGERPWGDTVCDPWISDRETVSKLRG*

Sequence

>CNT3092080
GAAAAGAATGCATTGGATGGATGCCCGGGCATTGAGAAGGAAGGACGCTTTCAGAGGCGAAAGGCCATGGGGAGATACCGTCTGTGATCCATGGATCTCC
GATCGGGAAACCGTATCCAAGCTCCGTGGCTAGTCTGCGCTCTTTGGACTTTTCAAACTTAGCGAACTGAAACATCTTAGTAGCTAAAGGAAGGGAAATC
AACCGAGACCCCCTTGAAAGCCGCCGCCCTTTAAATTTAAAGGAGCGGGCGCAGTGAACTGTAATTGTGAAAAGATTGGAAGATCTGGCCAAAGAAGGTG
ATAGCCCTGTAGATTCGTTCCCATGGTTCGATCCTTCCCAGTAAAACGCGGCGTGTTCGAATTCTGATCGCTTTTACGCGAGAAAGGGGGACCACCCTCT
AAGCCTAAGTATTCCTCAATGACCGATAGCGTACAAGTACCGTGAGGGAAAGGTGAAAAGAACCCTATTTAGGGAGTGCAATAGAGAACCTGAGATCCGA
TGCGAACAATCAGTCGAAGGAGCGGAGCTTAGAGCCTTTACTTTATGTAAAGCGCACTCACTCTAACGGCGTACCTAATTAAT