Detailed information on CNT3091731


BLAST search results

BLAST vs Swiss-Prot:
sp|P27492|CB21_TOBAC, E-value = 2e-101

BLAST vs NONCODE:
NONMTRT001605, E-value = 8e-101

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30709643Solanum tuberosumGlycine max82.0544.1386.59425forward

Expression of CNT3091731

Peptides detected in this lncRNA

>peptide 1 (29 aa)
MDQAWVAQVVKSTLAEDLGSGLEPHSLTEL

>peptide 2 (98 aa)
NKISLYCQVAHYIFTRSSNDQKLENVLIFLFSGDKVCGVGPCVVVDWVCKVVSKVLQWTLSGNNGLNEESKHREHSKSAVLNLLYFELSKCLWVFSKA*

>peptide 3 (45 aa)
KQNFIILSGSTLHLYTVIKRPETRECFNIFIFRGQSLWRRTMRCC*

>peptide 4 (67 aa)
MPLGLQQGLMGQSCHQGRVGRQPHQEVHQQYGNLQRLPSRQLGKPRWPRCSVHGPSLGCPSSQVHPR*

Sequence

>CNT3091731
CAAACAAAATTTCATTATATTGTCAGGTAGCACACTACATCTTTACACGGTCATCAAACGACCAGAAACTAGAGAATGTTTTAATATTTTTATTTTCCGG
GGACAAAGTTTGTGGCGTAGGACCATGCGTTGTTGTTGACTGGGTCTGCAAGGTGGTCAGCAAGGTTCTCCAATGGACCCTTTCCGGTAACAATGGCCTG
AACGAAGAATCCAAACATAGAGAACATAGCAAGTCTGCCGTTCTTAATCTCCTTTACTTTGAGCTCAGCAAATGCCTCTGGGTCTTCAGCAAGGCCTAAT
GGGTCAAAGCTGCCACCAGGGTAGAGTGGGTCGACAACCTCACCAAGAGGTCCACCAGCAATACGGTAACCTTCAACGGCTCCCATCAAGACAACTTGGC
AAGCCCAGATGGCCAAGATGCTCTGTGCATGGACCAAGCTTGGGTTGCCCAAGTAGTCAAGTCCACCCTCGCTGAAGATCTGGGATCCGGCCTTGAACCA
CACAGCCTCACCGAACTT