Detailed information on CNT3091645


BLAST search results

BLAST vs Swiss-Prot:
sp|P27493|CB22_TOBAC, E-value = 4e-156

BLAST vs NONCODE:
NONSTUT001352, E-value = 9e-124

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30728214Solanum tuberosumCorchorus capsularis39.0650.4885.65425forward
CNT30202642Solanum tuberosumHelianthus annuus30.6159.7887.69333forward
CNT30356707Solanum tuberosumLactuca sativa42.7439.9888.82465forward

Expression of CNT3091645

Peptides detected in this lncRNA

>peptide 1 (56 aa)
MKLSTEQPFKHKQNFIILSGSTLHLYTVIKRPETRECFNIFIFRGQSLWRRTMRCC*

>peptide 2 (67 aa)
MPLGLQQGLMGQSCHQGRVGRQPHQEVHQQYGNLQRLPSRQLGKPRWPRCSVHGPSLGCPSSQVHPR*

>peptide 3 (36 aa)
MDQAWVAQVVKSTLAEDLGSGLEPHSLTELDTITGQ*

Sequence

>CNT3091645
CAGTGCTTGATTCATGGGTTGACTTAGGAAAATGAAACTCAGTACAGAACAGCCATTCAAACACAAACAAAATTTCATTATATTGTCAGGTAGCACACTA
CATCTTTACACGGTCATCAAACGACCAGAAACTAGAGAATGTTTTAATATTTTTATTTTCCGGGGACAAAGTTTGTGGCGTAGGACCATGCGTTGTTGTT
GACTGGGTCTGCAAGGTGGTCAGCAAGGTGGTCAGCAAGGTTCTCCAATGGACCCTTTCCGGTAACAATGGCCTGAACGAAGAATCCAAACATAGAGAAC
ATAGCAAGTCTGCCGTTCTTAATCTCCTTTACTTTGAGCTCAGCAAATGCCTCTGGGTCTTCAGCAAGGCCTAATGGGTCAAAGCTGCCACCAGGGTAGA
GTGGGTCGACAACCTCACCAAGAGGTCCACCAGCAATACGGTAACCTTCAACGGCTCCCATCAAGACAACTTGGCAAGCCCAGATGGCCAAGATGCTCTG
TGCATGGACCAAGCTTGGGTTGCCCAAGTAGTCAAGTCCACCCTCGCTGAAGATCTGGGATCCGGCCTTGAACCACACAGCCTCACCGAACTTGACACCA
TTACGGGCCAATAGCTCAGGGAAGACACATCCAAGAGCACCAAGCATAGCCCATCTGCAGTGGATCACCTCAAGTTCACGGTTCTTGGCAAAGGTCTCAG
GGTCTGCTGAAAGTCCAGCGGTATCCCATCCATAGTCACCAGGGAATTCGCCAGTCAAGTAGCTTGGGGACTCACCAGAGAATGGGCCCAAGTACTTAAC
ACGGTCCGTAGTCACCAGGGAATTCACCGGTCAAGTAGCTTGGGGACTCACCAGAGAATGGGCCCAAGTACTTAACACGGTCAGGGCCATACCATGGGCT
GCTAGATGGGGCAGACTTGGCGACAGCCTTTCTCATAGTGATCCTTCCATTTCCAGTGATTTCTGAGGCAGAGGGTGAGAGTTTCACTGCCTGTCCAGCA
AAAGAAGGGGAAGAAAGAGCCATTGTAGCAGCTGCCATGGTTTATAAAGAGAGGAAAGTGAGGGGGTTGCTAGTTTGATATGTAAAAG