Detailed information on CNT309049


BLAST search results

BLAST vs Swiss-Prot:
sp|Q60E70|COBL3_ORYSJ, E-value = 6e-41

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT309049

Peptides detected in this lncRNA

>peptide 1 (31 aa)
MVRNKQFDPSCNLRNRNRLNNMMLLHLNSRK*

>peptide 2 (32 aa)
RTLEQQHHEDLVFLFVVVGGWLGTNSLILHAI*

>peptide 3 (86 aa)
MGNLLRAWVTLRPSAEKNFVGLPTIARPHVYPGPGVLRVKFFGTLTVLLVVPARPTLIWKEEAAFAGSWLKQWGVLPLNFEQSPCSV

Sequence

>CNT309049
CGGACGCTTGAGCAGCAGCACCATGAAGACCTGGTATTTCTCTTCGTGGTGGTTGGTGGATGGTTAGGAACAAACAGTTTGATCCTTCATGCAATCTAAG
GAATAGGAACAGACTGAATAATATGATGCTGCTGCACCTCAACTCCAGAAAGTAAAACGTGGAAGTTCAGTATATGGGCAACTTACTTAGAGCTTGGGTT
ACCCTGCGCCCATCTGCAGAGAAAAACTTCGTTGGCCTGCCAACAATAGCACGCCCACATGTGTACCCAGGGCCTGGAGTCTTAAGAGTGAAATTCTTCG
GCACCTTAACAGTTTTATTGGTAGTTCCAGCAAGACCAACACTGATCTGGAAGGAGGAAGCAGCATTTGCTGGGTCCTGGTTAAAGCAATGGGGGGTGTT
GCCCTTGAACTTTGAGCAGTCACCCTGTTCAGTGG