Detailed information on CNT3090332


BLAST search results

BLAST vs Swiss-Prot:
sp|Q307Y9|METK1_SOLTU, E-value = 1e-121

BLAST vs NONCODE:
NONPOPT000587, E-value = 3e-51

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30672441Solanum tuberosumSetaria viridis28.4623.8788.65185forward
CNT30520816Solanum tuberosumSetaria italica28.9221.7688.83188forward
CNT30641080Solanum tuberosumNymphaea colorata34.6225.1482.22225forward
CNT30549907Solanum tuberosumIpomoea triloba38.4646.5587.2250forward
CNT30515028Solanum tuberosumJuglans regia38.6229.5684.06251forward
CNT30698521Solanum tuberosumQuercus lobata29.5434.2283.85192forward
CNT30373104Solanum tuberosumArabidopsis thaliana39.3830.5185.16256forward
CNT30618114Solanum tuberosumSesamum indicum33.0847.5784.19215forward
CNT30266655Solanum tuberosumChenopodium quinoa56.1532.4788.49365forward
CNT3021108Solanum tuberosumCitrullus lanatus41.5416.485.56270forward
CNT30381524Solanum tuberosumManihot esculenta40.3131.6884.73262forward
CNT30402638Solanum tuberosumBeta vulgaris43.0821.8685280forward
CNT30524850Solanum tuberosumPhaseolus vulgaris40.9236.8484.59266forward
CNT30628391Solanum tuberosumVigna unguiculata40.9223.1983.83266forward
CNT30194995Solanum tuberosumPisum sativum37.2325.4288.84242forward
CNT30495282Solanum tuberosumOlea europaea49.2318.1785.31320forward
CNT30712013Solanum tuberosumGlycine max50.1572.9384.36326forward
CNT3047443Solanum tuberosumPrunus dulcis33.5418.2787.16218forward
CNT30158121Solanum tuberosumPistacia vera41.3843.0484.39269forward
CNT30638840Solanum tuberosumCapsicum annuum3425.8894.57221forward
CNT30190465Solanum tuberosumSecale cereale28.9265.2886.17188forward
CNT30294498Solanum tuberosumTriticum aestivum40.9233.2984.21266forward
CNT30225616Solanum tuberosumHordeum vulgare18.3149.7985.71119forward
CNT30389985Solanum tuberosumTriticum turgidum29.3818.7886.91191forward
CNT30561874Solanum tuberosumActinidia chinensis29.3821.6686.91191forward
CNT3086110Solanum tuberosumVigna radiata34.6220.1383.56225forward
CNT30508429Solanum tuberosumSolanum lycopersicum18.3148.1896.64119forward
CNT30174161Solanum tuberosumTrifolium pratense50.3141.4486.24327forward
CNT30144438Solanum tuberosumMedicago truncatula37.2349.4986.78242forward
CNT30441436Solanum tuberosumAegilops tauschii26.6234.1282.08173forward
CNT30662024Solanum tuberosumTriticum dicoccoides2430.7185.9156forward
CNT30310308Solanum tuberosumCamelina sativa16.9247.6286.36110forward
CNT3082721Solanum tuberosumBrassica juncea25.6957.7983.23167forward
CNT30471855Solanum tuberosumSaccharum spontaneum53.8538.0483.71350forward
CNT3013982Solanum tuberosumZea mays23.5452.7688.89153forward
CNT30606743Solanum tuberosumGossypium raimondii27.3816.6784.27178forward
CNT30218668Solanum tuberosumKalanchoe fedtschenkoi18.1530.4983.9118forward
CNT3066706Solanum tuberosumLeersia perrieri2038.2486.15130forward
CNT30650534Solanum tuberosumRosa chinensis56.1539.1685.75365forward
CNT30212612Solanum tuberosumHelianthus annuus33.0889.2182.33215forward
CNT30624603Solanum tuberosumDaucus carota42.9242.2785.66279forward
CNT30681758Solanum tuberosumTriticum urartu39.3837.5484.38256forward
CNT30349162Solanum tuberosumEragrostis tef41.8529.8683.82272forward
CNT30368076Solanum tuberosumSorghum bicolor52.9231.5984.01344forward
CNT30620812Solanum tuberosumCajanus cajan28.6214.9882.8186forward
CNT30597062Solanum tuberosumOryza meridionalis43.6925.8284.15284forward
CNT30358838Solanum tuberosumLactuca sativa20.3119.381.06132forward
CNT30571189Solanum tuberosumVitis vinifera41.2343.5187.69268forward
CNT3055164Solanum tuberosumAmborella trichopoda28.4616.0983.24185forward
CNT3022500Solanum tuberosumPopulus trichocarpa47.8546.4284.57311forward
CNT3035650Solanum tuberosumCucumis melo45.3821.8887.46295forward
CNT30148817Solanum tuberosumBrachypodium distachyon49.6927.9482.66323forward
CNT30101810Solanum tuberosumOryza rufipogon48.7712.584.23317forward
CNT30116702Solanum tuberosumOryza nivara34.4621.8182.59224forward
CNT30174546Solanum tuberosumVigna angularis50.7743.1483.94330forward
CNT30113329Solanum tuberosumFicus carica26.6216.0687.28173forward
CNT30725315Solanum tuberosumLupinus angustifolius43.0827.8383.93280forward

Expression of CNT3090332

Peptides detected in this lncRNA

>peptide 1 (99 aa)
DFTTSETSITMRSTNNKSARWVKVEDCLLVKVLLWDDWLDDMLLKVAGNLIICNGLIVLGGDKNSVYLNWNHGTIVIAILNSNLSFAIRPQPGAGGHQV*

>peptide 2 (80 aa)
MAVDTLSNIRTLLLNVNKDLAVISIKTNIIRNKSNITACVTHNLLIVYNSLGRDLTKDHDQVGLGASFTCNFALRILLKAG

>peptide 3 (48 aa)
MTGLMTCSLRSRAISSFVTVSSCWVEIRTVCTLIGIMAPLSLQYSTVT*

Sequence

>CNT3090332
GATTTTACGACCAGTGAGACCAGCATCACCATGAGGTCCACCAATAACAAATCGGCCAGATGGGTTAAGGTGGAAGATTGTCTTCTCGTCAAGGTACTTC
TCTGGGATGACTGGCTTGATGACATGCTCCTTAAGGTCGCGGGCAATCTCATCATTTGTAACGGTCTCATCGTGTTGGGTGGAGATAAGAACAGTGTGTA
CCTTAATTGGAATCATGGCACCATTGTCATTGCAATACTCAACAGTAACTTGAGTTTTGCCATCAGGCCTCAACCAGGGGCAGGCGGGCACCAAGTTTAG
TTGCAAGCACGTGACTGAGAGGCATTAATTCAGGGGTCTCATCGGTGGCATAGCCAAACATGTGACCCTGGTCACCAGCACCAATCTCCTCGGGGCGTTT
GGTCAGATGGCCGTGGACACCTTGAGCAATATCAGGACTTTGCTGCTCAATGTAAACAAGGACCTTGCAGTTATCAGCATCAAGACCAACATCATCAGAA
ACAAATCCAATATTACGGCATGTGTCACGCACAATCTTCTCATAGTCTACAATAGCCTTGGTCGTGATCTCACCAAAGACCATGACCAAGTTGGTCTTGG
TGCAAGTTTCACATGCAACTTTGCTCTCAGGATCTTGCTCAAGGCAGGCG