Detailed information on CNT3088211


BLAST search results

BLAST vs Swiss-Prot:
sp|Q00451|PRF1_SOLLC, E-value = 2e-21

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30630205Vigna radiataVigna unguiculata40.716.0797.14245forward
CNT30198269Vigna radiataPisum sativum47.6733.7379.79287forward
CNT30712866Vigna radiataGlycine max45.0230.6991.51271forward
CNT3045441Vigna radiataPrunus dulcis32.5614.4183.67196forward
CNT30632655Vigna radiataCapsicum annuum21.110.1981.1127forward
CNT3094864Vigna radiataSolanum tuberosum28.7418.880.92173forward
CNT30171405Vigna radiataTrifolium pratense49.3428.3780.13297forward
CNT30718939Vigna radiataMalus domestica golden34.8825.3681.9210forward
CNT30153077Vigna radiataPrunus persica32.5612.4883.67196forward
CNT30706199Vigna radiataPrunus avium31.231681.38188forward

Expression of CNT3088211

Peptides detected in this lncRNA

>peptide 1 (69 aa)
GLATVNEKLKSNGDYDVDVKDLGPNGCAETNCSIQVNKPCKNWTTCLFSTASNTYVDEATEHIHTRSQF*

>peptide 2 (56 aa)
MLVVLVEGMAPLVVVVDMVFHLEGLGVSQWVELVELVAKEPQEEGSQWVVLAHKVV*

>peptide 3 (97 aa)
MGIMMLMLRILALMVVQRQTAASKSTSPARTGQHVCLALLPIPMWMRPPSTSTHAPSFRESIGHVGCAGGGYGTTGGGGGHGVSLGGLGGVTVGGVG*

Sequence

>CNT3088211
GGGGTCTTGCCACAGTCAATGAGAAGCTGAAGAGCAATGGGGATTATGATGTTGATGTTAAGGATCTTGGCCCTAATGGTTGTGCAGAGACAAACTGCAG
CATCCAAGTCAACAAGCCCTGCAAGAACTGGACAACATGTCTGTTTAGCACTGCTTCCAATACCTATGTGGATGAGGCCACCGAGCACATCCACACACGC
TCCCAGTTTTAGAGAGTCAATAGGGCATGTTGGTTGTGCTGGTGGAGGGTATGGCACCACTGGTGGTGGTGGTGGACATGGTGTTTCACTTGGAGGGCTT
GGGGGTGTCACAGTGGGTGGAGTTGGTTGAACTGGTGGCAAAGGAACCACAGGAGGAGGGTTCACAATGGGTGGTTTTGGCACATAAGGTGGTGTAACGG
GGACAACCGGAGGTTTTGGGATGTAAGGAGGAATAACTGGTACAACCGGTGGTTTAGGGATGTAGGGTGGTGTGACAACCGGTGGTTTAGGGATGTAAGG
TGGTGTGACAACCGGTGGTTTGGGGACATATGGGGGTGGTTTGACAACTGGGGGTAGTGGAACATAAGGGGGATGTGGGTGAACTGGCGGTCTAGGGTGA
GG