Detailed information on CNT3088050


BLAST search results

BLAST vs Swiss-Prot:
sp|P48387|CHS2_CAMSI, E-value = 2e-76

BLAST vs NONCODE:
NONPOPT000627, E-value = 5e-28

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30378024Vigna radiataArabidopsis thaliana29.2826.6882.99147forward
CNT30628476Vigna radiataVigna unguiculata59.9639.8791.69301forward
CNT30712683Vigna radiataGlycine max29.8854.7484150forward
CNT30192533Vigna radiataSecale cereale53.7840.4281.11270forward
CNT30251850Vigna radiataAvena sativa41.4315.5378.85208forward
CNT30466546Vigna radiataSaccharum spontaneum51.9998.1281.99261forward
CNT30606750Vigna radiataGossypium raimondii49.432.9381.05248forward
CNT30128449Vigna radiataCorymbia citriodora20.9225.7482.86105forward
CNT30680228Vigna radiataTriticum urartu26.6928.3984.33134forward
CNT30365392Vigna radiataSorghum bicolor64.9456.2182.52326forward
CNT30355776Vigna radiataLactuca sativa32.0727.7685.09161forward
CNT3022840Vigna radiataPopulus trichocarpa26.113.4583.97131forward
CNT30103826Vigna radiataOryza rufipogon38.8428.2285.13195forward
CNT30593102Vigna radiataEragrostis curvula8.9620.7493.3345forward
CNT30114125Vigna radiataFicus carica57.3737.3182.29288forward

Expression of CNT3088050

Peptides detected in this lncRNA

>peptide 1 (35 aa)
MSCLTSSENGGGAMGTLGVADFLDCDHLEVCGWQR*

>peptide 2 (65 aa)
SRWASEGPRNVTAVISEQTTRTRAPLLFSARSLARRSTVPPAKQPCWYIMRRLTEGLRPRSLVSW*

>peptide 3 (74 aa)
VEVGIGGAAERHGSDFGADYEDAGALVVLGEVLGKTEHGAAGEAALLVHHETFDGRPEAEKLGELVIRSRHVDA*

>peptide 4 (36 aa)
MVAGPWERWALRISSTVTIWRCADGRGKGEKAVRRE*

Sequence

>CNT3088050
GTCGAGGTGGGCATCGGAGGGGCCGCGGAACGTCACGGCAGTGATTTCGGAGCAGACTACGAGGACGCGGGCGCCCTTGTTGTTCTCGGCGAGGTCCTTG
GCAAGACGGAGCACGGTGCCGCCGGCGAAGCAGCCCTGCTGGTACATCATGAGACGTTTGACGGAAGGCCTGAGGCCGAGAAGCTTGGTGAGCTGGTAAT
CCGCTCCAGGCATGTCGACGCCTGAAGTGGTGCAAAATACCAGGTGTGTGATCTTTGACTTAGGTTGACCCCACTCCTTTATCGCCTTCCTCGCCGCTTC
TTTTCCGAGCTTCGGCACTTCCACAACCACTATGTCCTGCCTCACGTCCAGCGAGAATGGTGGCGGGGCCATGGGAACGCTGGGCGTTGCGGATTTCCTC
GACTGTGACCATCTGGAGGTGTGCGGATGGCAGAGGTAAAGGAGAGAAAGCGGTTAGAAGAGAGTGAGAGTGAAAGTGAGAGAGATGAAAGGTGAGTGAG
GT