Detailed information on CNT3088000


BLAST search results

BLAST vs Swiss-Prot:
sp|P0CG83|UBIQP_HORVU, E-value = 7e-95

BLAST vs NONCODE:
NONMEST001181, E-value = 1e-104

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30477838Vigna radiataArabidopsis halleri40.8180.8285.49455forward
CNT30620193Vigna radiataCajanus cajan41.7972.5989.48466forward
CNT30176450Vigna radiataVigna angularis64.5765.4595.28720forward

Expression of CNT3088000

Peptides detected in this lncRNA

>peptide 1 (40 aa)
MVSELSTSRVIVFPVRVLTNICIPPRRRRTRCRVDSFWML*

>peptide 2 (45 aa)
MKLILMDYKRLLIAMKLKQIYLTGQQRPIQRKLLNLKTTAQKEEL*

>peptide 3 (49 aa)
MVSELSTSRVMVLPVKVLTKICICTVIPNQQINQNQTRIRILIRIIEQI*

Sequence

>CNT3088000
GGCAAAGTATGAAAAAACGAAATAGCAGATACTAAATTTCAAAGCGAATGAAGTTGATATTAATGGATTACAAAAGGTTGTTGATAGCAATGAAGTTAAA
ACAAATTTATTTAACGGGTCAACAGAGACCCATACAGAGAAAGTTGTTAAATTTGAAGACAACAGCCCAGAAAGAGGAGTTATAGTACTTAAAAACCACC
ACGAAGACGCAGGACAAGGTGAAGGGTTGACTCCTTCTGGATGTTGTAGTCTGCAAGGGTGCGGCCATCCTCAAGCTGCTTACCAGCAAAAATCAACCTC
TGCTGGTCTGGGGGAATGCCCTCTTTGTCCTGAATCTTAGCCTTCACATTGTCAATGGTGTCTGAGCTCTCCACCTCAAGGGTGATTGTCTTTCCGGTAA
GGGTCTTAACGAATATCTGCATTCCTCCACGTAGACGGAGGACCAGATGCAGGGTTGACTCCTTCTGGATGTTGTAGTCAGCCAGGGTGCGACCATCCTC
CAGTTGCTTTCCGGCGAAGATCAAACGCTGCTGGTCCGGTGGAATCCCTTCTTTGTCCTGAATTTTGGACTTTACGTTGTCGATGGTGTCGGAACTCTCC
ACCTCAAGAGTTATGGTCTTACCAGTCAAGGTCTTAACGAAGATTTGCATCTGCACCGTCATACCCAACCAACAGATAAATCAAAATCAAACCAGAATAA
GAATCTTAATTAGAATAATTGAACAAATTTAGGGCTCAACTCCAGATCAAAATCACGATCTCCAAACACAAAACTAAAAATAAAGCATCACACACACAAA
AACTTAAAATTCAAAGCCTGGAATGTTAAGAACGTCCATAAGATTTCTTTATCAGGTTTAAAAGGCAGCAGCGAACAGCGTAAAACGACAATCACAGGAT
TCAGGTTCGCAGAACCATACACCAATTGCGGTAAAATTAAAAACCTAACAGATTTTTCAGATGCATAAAAACCAAAATATTGAATTGCAGATAGATGATA
AAAACCTATGAAATGAAAAATTAGGAGGCTAAGCGGAAGATTTAAAAGAAGGAGAAGAGGAGAAACACACCTTGAAAGATTTGAATGAACCGAAACGATA
AAAATGAGATTGAAT