Detailed information on CNT308797


BLAST search results

BLAST vs Swiss-Prot:
sp|Q07300|ATPD_SORBI, E-value = 1e-91

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30670986Zea maysSetaria viridis18.7551.193.83162forward
CNT30519894Zea maysSetaria italica63.4357.4495.07548forward
CNT30226052Zea maysHordeum vulgare21.0644.8386.81182forward
CNT30441539Zea maysAegilops tauschii15.6234.6290.37135forward
CNT30460882Zea maysSaccharum spontaneum60.8869.9596.58526forward
CNT30364427Zea maysSorghum bicolor8.2234.887.3271forward
CNT30595678Zea maysOryza meridionalis30.7945.3990.6266forward
CNT30369630Zea maysOryza glumipatula25.8129.0790.13223forward
CNT30556377Zea maysPanicum hallii43.1781.6293.83373forward

Expression of CNT308797

Peptides detected in this lncRNA

>peptide 1 (96 aa)
MDASSRPQTSSGTAGNSNSDAISSICFRTLMSIKLEPSRPYCTVKPAMSAGSSCVLRRTFLAPVIFWTCCAICARSCDSSCTTEVTVATSVPVSEL*

>peptide 2 (79 aa)
MDARKLSTTTLRKLTTCGCSSDDLAISPMSSAFSSRGTVGLSKNSATASSAKIFSSFSRSETVCSRVPFSTATSDSADA*

Sequence

>CNT308797
CCGCCAACCGAAACGCACAAAAATAGGGTCCGTTCATATATGTATCGGAGATTTGGAGCCACCACCGTTGATCCGCAGGTCTGAGTGACTGAAGGGGACA
GGGCCAACATTCCCGCTTGGATGGACGCCTCAAGCCGGCCTCAGACTTCGAGCGGGACGGCGGGCAACTCGAACTCGGACGCGATCTCCTCGATCTGCTT
CCGGACGCTCATGTCGATCAAGTTGGAGCCGTCGCGGCCGTACTGCACGGTGAAGCCGGCGATGAGCGCCGGGTCGAGCTGCGTCTTGAGGCGGACGTTC
TTGGCGCCGGTCATCTTCTGGACGTGCTGCGCGATCTGCGCGAGGTCCTGCGACTCGAGCTGCACGACGGAGGTGACGGTGGCGACCTCGGTGCCGGTGA
GCGAGTTGTAGACGTTCTCGAACTCGACGACGATCTGCGGCACGATGGACGCGCGGAAGTTGTCGACGACGACGTTGAGGAAGTTGACGACGTGCGGCTG
CAGCTCGGACGACTTGGCGATCTCGCCGATGAGCTCGGCCTTCTCCTCGCGCGGGACGGTGGGGTTGTCGAAGAACTCGGCGACGGCCTCGTCGGCGAAG
ATCTTCTCCAGCTTCTCGAGGTCGGAGACCGTCTGCTCGAGGGTGCCGTTCTCGACGGCCACCTCCGACAGCGCGGACGCGTAGCTCTCCGCCGCGGCCT
CGGCCGCGGCGCGGGGCCTGGCGAGGTCCCCGCGGCGGCGGCGGCGGCGGCGGGGCGGAGGGTGAAGGAGGCGAGGCGGAGCGCGGCCATCGCGTCGCGG
AGCGTGCGGTCGGAGAGTGGACTCGTGGGGGAGTGCGGCCTCGCTCTTGTTCGGGAATCGGGAC