Detailed information on CNT3087909


BLAST search results

BLAST vs Swiss-Prot:
sp|P0CH33|UBQ11_ARATH, E-value = 2e-150

BLAST vs NONCODE:
NONMEST001181, E-value = 3e-161

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT3087909

Peptides detected in this lncRNA

>peptide 1 (49 aa)
MVSELSTSRVMVLPVKVLTKICICTVIPNQQINQNQTRIRILIRIIEQI*

>peptide 2 (45 aa)
MKLILMDYKRLLIAMKLKQIYLTGQQRPIQRKLLNLKTTAQKEEL*

>peptide 3 (40 aa)
MVSELSTSRVIVFPVRVLTNICIPPRRRRTRCRVDSFWML*

Sequence

>CNT3087909
GGCAAAGTATGAAAAAACGAAATAGCAGATACTAAATTTCAAAGCGAATGAAGTTGATATTAATGGATTACAAAAGGTTGTTGATAGCAATGAAGTTAAA
ACAAATTTATTTAACGGGTCAACAGAGACCCATACAGAGAAAGTTGTTAAATTTGAAGACAACAGCCCAGAAAGAGGAGTTATAGTACTTAAAAACCACC
ACGAAGACGCAGGACAAGGTGAAGGGTGGACTCCTTCTGGATATTGTAGTCAGCAAGGGTCCTCCCATCTTCCAACTGCTTCCCTGCGAAGATCAGTCTC
TGCTGGTCCGGTGGAATTCCCTCCTTGTCCTGAATTTTTGCCTTCACATTGTCGATAGTGTCAGAACTCTCAACCTCCAGAGTGATGGTCTTCCCAGTCA
AGGTCTTAACAAAAATCTGCATCCCACCCCTGAGTCGGAGTACAAGGTGAAGGGTTGACTCCTTCTGGATGTTGTAGTCTGCAAGGGTGCGGCCATCCTC
AAGCTGCTTACCAGCAAAAATCAACCTCTGCTGGTCTGGGGGAATGCCCTCTTTGTCCTGAATCTTAGCCTTCACATTGTCAATGGTGTCTGAGCTCTCC
ACCTCAAGGGTGATTGTCTTTCCGGTAAGGGTCTTAACGAATATCTGCATTCCTCCACGTAGACGGAGGACCAGATGCAGGGTTGACTCCTTCTGGATGT
TGTAGTCAGCCAGGGTGCGACCATCCTCCAGTTGCTTTCCGGCGAAGATCAAACGCTGCTGGTCCGGTGGAATCCCTTCTTTGTCCTGAATTTTGGACTT
TACGTTGTCGATGGTGTCGGAACTCTCCACCTCAAGAGTTATGGTCTTACCAGTCAAGGTCTTAACGAAGATTTGCATCTGCACCGTCATACCCAACCAA
CAGATAAATCAAAATCAAACCAGAATAAGAATCTTAATTAGAATAATTGAACAAATTTAGGGCTCAACTCCAGATCAAAATCACGATCTCCAAACACAAA
ACTAAAAATAAAGCATCACACACACAAAAACTTAAAATTCAAAGCCTGGAATGTTAAGAACGTCCATAAGATTTCTTTATCAGGTTTAAAAGGCAGCAGC
GAACAGCGTAAAACGACAATCACAGGATTCAGGTTCGCAGAACCATACACCAATTGCGGTAAAATTAAAAACCTAACAGATTTTTCAGATGCATAAAAAC
CAAAATATTGAATTGCAGATAGATGATAAAAACCTATGAAATGAAAAATTAGGAGGCTAAGCGGAAGATTTAAAAGAAGGAGAAGAGGAGAAACACACCT
TGAAAGATTTGAATGAACCGAAACGATAAAAATGAGATTGAAT