Detailed information on CNT30877


BLAST search results

BLAST vs Swiss-Prot:
sp|Q10HD0|CB23_ORYSJ, E-value = 5e-129

BLAST vs NONCODE:
NONBNAT005173, E-value = 1e-35

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30677497Zea maysSetaria viridis19.6234.0195.81167forward
CNT30522168Zea maysSetaria italica62.6361.1996.06533forward
CNT30298089Zea maysTriticum aestivum39.1348.0590.09333forward
CNT30589923Zea maysMusa acuminata5399.3487.58451forward
CNT30246635Zea maysAvena sativa57.3499.883.81488forward
CNT30142779Zea maysLolium perenne65.6963.0283.72559forward
CNT30685647Zea maysTriticum urartu57.8166.3188.21492forward
CNT30579738Zea maysEchinochloa crusgalli66.0448.0394.84562forward
CNT30498674Zea maysDigitaria exilis36.5545.9492.28311forward

Expression of CNT30877

Peptides detected in this lncRNA

>peptide 1 (31 aa)
MAQAIDRLIHPLMTIHASVLSLHRPLTAGSH*

>peptide 2 (47 aa)
MDLMVVHMYGVAQSVSCRGRSSWRMPRRCWRRGRRRGRRGSRWGPCR*

>peptide 3 (41 aa)
MSPGRPRGPRCPTRSRRGTRRSGTTASARRTGQDTWGDQGRT

>peptide 4 (65 aa)
MGPLPVTMACTKKPNMENMARRPFLSSFTLSSAAVSGSSARPSGTTWHAQMARMLCACTRLGFPR*

Sequence

>CNT30877
GATCGATTCAAAAATGAATGGCACAGGCCATCGATAGATTGATTCATCCACTGATGACGATACATGCGTCTGTGCTTAGTTTACATCGACCGCTTACAGC
AGGCAGCCATTGACATTGATTGATGAGCACACATCGATCATGAGCATACGCCGGCTGGTGCAACTACTACACGCCTACGATCTGAACAAGTAGAGTACAG
AGAAGACCACACTGTTCACTCGACGGACGGACGAACGAATGGATGGATCTGATGGTAGTACACATGTACGGCGTTGCTCAGTCAGTTAGTTGCCGGGGAC
GAAGTTCGTGGCGTATGCCCAGGCGTTGTTGGCGACGGGGTCGGCGACGTGGTCGAAGAGGTTCTCGATGGGGCCCTTGCCGGTGACGATGGCCTGCACG
AAGAAGCCGAACATGGAGAACATGGCAAGGCGGCCGTTCTTGAGCTCCTTCACCTTGAGCTCGGCGGCGGTGTCCGGGTCGTCGGCGAGGCCCAGCGGCA
CCACCTGGCACGCCCAGATGGCCAGGATGCTCTGTGCGTGCACCAGGTTGGGGTTCCCCAGGTAGTCCAGCCCGCCCTCCGAGAAGATCTGCGCGCCGGC
CTTGAACCACACCGCCTCGCCGAACTTGACGCCGTTCTTGGCCAGGATCTCCGGGAACACGCAGCCCAGCGCGCCCAGCATCGCCCACCGGGAGTGGATC
ACCTCCAGCTCCCGGTTGCGCGCGAATGTCTCCGGGTCGGCCGAGAGGCCCGCGGTGTCCCACCCGTAGTCGCCGGGGAACTCGCCGGTCAGGTACGACG
GCGTCTGCTCGGAGAACGGGCCAAGATACTTGGGGCGATCAGGGCCGTACC