Detailed information on CNT3087156


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT3087156

Peptides detected in this lncRNA

>peptide 1 (61 aa)
MDGCCWGTNNFIYSTLSYILPLIIRLIKLLXDFLSLPLTRSLGEKGLISITGLLSLASPSN*

>peptide 2 (32 aa)
MLIQLTSENNGWMDVVGVPTISSIPLSLTYYP*

Sequence

>CNT3087156
AATAATAAGACTTGAAAAATAAAATTTAATAAATTGGATTTTGAGGAAAAAAAATATTAACATGGAAAATAAATGTTGATTCAATTGACAAGTGAAAACA
ATGGATGGATGGATGTTGTTGGGGTACCAACAATTTCATCTATTCCACTCTCTCTTACATACTACCCTTGATTATTAGATTGATTAAATTGTTATGNGAC
TTTCTTAGCCTCCCCTTAACCCGATCCCTCGGCGAAAAGGGCCTAATATCAATTACCGGCTTGCTATCCCTAGCCTCCCCTAGTAATTAATACCGCATTA
TAAACAGAAGTTAGCACAATTGATCGTCCTACCCCTATCCCTAGGTGGTATTGCAAAATCAAGAGATTACTCACCAGTTCATGTCATTACTGTACGTCCC
CATATCAATAACGAC