Detailed information on CNT3086449


BLAST search results

BLAST vs Swiss-Prot:
sp|P0CG85|UBI1P_NICSY, E-value = 0.0

BLAST vs NONCODE:
NONMEST001181, E-value = 1e-145

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30512879Vigna radiataJuglans regia50.0381.7982.57786forward
CNT30701438Vigna radiataQuercus lobata70.6676.0881.531110forward
CNT3069553Vigna radiataQuercus suber38.6483.9683.03607forward
CNT30525132Vigna radiataPhaseolus vulgaris93.3292.0388.341466forward
CNT30629380Vigna radiataVigna unguiculata63.3485.1989.25995forward
CNT30145430Vigna radiataMedicago truncatula84.9876.0384.641335forward
CNT30624513Vigna radiataDaucus carota87.3386.8980.541372forward
CNT30432057Vigna radiataPapaver somniferum78.7477.1279.711237forward
CNT30706353Vigna radiataPrunus avium70.2762.5583.061104forward

Expression of CNT3086449

Peptides detected in this lncRNA

>peptide 1 (40 aa)
MVSELSTSKVMVFPVRVFTNICIPPRSLNTKCRVDSFWML*

>peptide 2 (40 aa)
MVSELSTSKVIVFPVRVFTNICIPPRSLNTKCRVDSFWML*

>peptide 3 (53 aa)
MQGRFLLNIVVCQGTTILQLLPSKNKPLLIWWDSLLVLNLCLHIIDCIRALHL*

>peptide 4 (30 aa)
MVFPVRVLTKICMPPRSLKTKCKVDSFWIL*

>peptide 5 (30 aa)
MVFPVKVFTKICMPPRSLKTKCKVDSFCML*

Sequence

>CNT3086449
TATATAAAATACTCACATATATAGTATATATAAAAAAAATACATTACCCATATATAAATATATAAAAAGCTATTTCTTAGTAGTTAACAAACAATAGCGA
TGATACACACATATACTAGTCTTAGAACATAAGAAAAACACCCAACCAGGAACTGCAACACACGATTTCAATTGACACTGGACATAATAGACACGAGGCT
TAGAAACCACCGCGAAGGCGAAGAACAAGATGCAGGGTAGATTCCTTCTGAATATTGTAGTCTGCCAAGGTACGACCATCCTCCAATTGCTTCCCAGCAA
AAATAAGCCTCTGCTGATCTGGTGGGATTCCCTCCTTGTCCTGAATCTTTGCCTTCACATTATCGATTGTATCAGAGCTCTCCACCTCTAAGGTAATGGT
TTTTCCCGTCAGAGTCTTGACAAAAATTTGCATGCCACCACGAAGCCTCAAAACCAAGTGCAAAGTGGACTCTTTCTGGATATTATAATCCGCAAGGGTT
CTTCCATCTTCAAGTTGTTTCCCAGCAAAGATAAGCCTCTGCTGATCTGGGGGAATACCCTCCTTATCCTGAATCTTGGCTTTGACATTATCAATGGTAT
CTGAACTCTCCACCTCCAAGGTAATGGTCTTCCCTGTCAGAGTCTTCACAAATATCTGCATTCCACCACGAAGCCTCAACACCAAGTGCAGAGTAGATTC
CTTCTGGATGTTATAATCAGCAAGGGTTCGCCCATCTTCCAGCTGCTTCCCAGCAAAGATAAGCCTTTGCTGGTCTGGTGGAATNCCCTCTTTGTCCTGG
ATCTTTGNCTTGACATTATCAATGGTATCAGAGCTTTCAACTTCCAAAGTAATTGTTTTCCCTGTCAGAGTCTTCACAAATATCTGCATTCCACCACGAA
GCCTCAACACCAAGTGTAGAGTGGATTCCTTCTGGATGTTATAATCTGCAAGGGTACGCCCATCTTCCAGCTGCTTCCCAGCAAAGATAAGTCTCTGCTG
GTCCGGTGGAATGCCTTCCTTGTCCTGAATCTTTGCCTTTACATTGTCAATAGTGTCAGAGCTTTCAACCTCCAGAGTTATGGTTTTCCCGGTTAAAGTC
TTCACAAAAATCTGCATGCCACCACGAAGCCTCAAAACCAAGTGCAAAGTGGATTCTTTCTGTATGTTATAATCCGCAAGGGTCCTTCCGTCTTCAAGCT
GTTTCCCGGCAAAGATAAGCCTCTGTTGATCTGGGGGTATACCCTCCTTATCCTGAATCTTTGTTTTCACATTGTCAATTGTATCTGAACTCTCCACTTC
CAAGGTTATGGTTTTTCCAGTCAAAGTCTTTACAAAAATCTGCATACCACCCCTCAACCGAAGCACCAAGTGGAGGGTGGACTCCTTCTGAATATTGTAA
TCGGCCAGGGTTCTCCCATCCTCAAGCTGTTTACCAGCAAAAATCAGCCTTTGCTGATCCGGAGGGATACCCTCTTTGTCCTGGATCTTAGCCTTGACAT
TATCAATGGTGTCAGACGATTCTACTTCAAGGGTTATGGTCTTGCCAGTCAAAGTTTTCACAAAGATCTGC