Detailed information on CNT3086176


BLAST search results

BLAST vs Swiss-Prot:
sp|P46486|PSAF_FLATR, E-value = 8e-100

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30641545Vigna radiataNymphaea colorata41.5339.5384.23336forward
CNT30629005Vigna radiataVigna unguiculata39.5654.8996.25320forward
CNT30709011Vigna radiataGlycine max56.8650.6688.48460forward
CNT30187643Vigna radiataSecale cereale45.2434.5680.33366forward
CNT30300474Vigna radiataTriticum aestivum45.2433.379.78366forward
CNT30224070Vigna radiataHordeum vulgare13.9750.6783.19113forward
CNT30394054Vigna radiataTriticum turgidum443680.06356forward
CNT30562388Vigna radiataActinidia chinensis45.4934.6283.97368forward
CNT30664762Vigna radiataTriticum dicoccoides4460.0380.06356forward
CNT308929Vigna radiataZea mays28.4376.4183.48230forward
CNT30716553Vigna radiataMalus domestica golden44.554.7978.61360forward
CNT30579105Vigna radiataEchinochloa crusgalli28.4321.7883.48230forward

Expression of CNT3086176

Peptides detected in this lncRNA

>peptide 1 (68 aa)
MARAAEKAFRSEDMLLLLSELLLGVALQTMVGRSLEPSLGRRAAGLDRLVGIVSDMVGCLERVCENGV*

>peptide 2 (68 aa)
IGLNILGNEVTVDELSVGSNGPTEPPEEQARGERNVDDDLLHRRFFLIPDGNKVAPTHPPDPPGDVQE*

>peptide 3 (37 aa)
MYRNRNPGVMNSPQCLWSPLTIRCGSPSAPHRRPCFA*

>peptide 4 (50 aa)
MTPASLSTASRALRTAWTPCTGSDRRWRGRRRRPSDRRICCCCCRSCCWE*

Sequence

>CNT3086176
AATTGGGCTAAACATCCTTGGCAATGAGGTCACCGTTGATGAGCTCTCTGTAGGCAGCAACGGGCCAACTGAACCCCCGGAAGAGCAAGCGAGAGGCGAG
AGGAACGTCGATGATGATCTCCTTCATCGTCGGTTTTTTCTCATCCCTGATGGCAATAAGGTAGCTCCGACCCACCCACCCGATCCACCCGGCGATGTAC
AGGAATAGGAACCCAGGAGTGATGAACTCGCCCCAGTGCCTCTGGTCCCCGCTCACGATCAGGTGCGGTAGCCCGTCGGCGCCGCACAGAAGACCCTGCT
TCGCGTAGTTGTCGAACCGCCGCTTCGTCTTCTCCACCGACGCCTTTATCGCCAGGGCGGGAGCGCTGTCCGGCGCGTACAGCTTCAGCGATGACTCCAG
CTTCTTTATCGACTGCTTCTCGCGCTTTGCGAACTGCTTGGACTCCTTGCACGGGGTCAGACCGGAGATGGCGAGGGCGGCGGAGAAGGCCTTCAGATCG
GAGGATATGTTGTTGTTGTTGTCGGAGTTGTTGTTGGGAGTAGCACTGCAGACGATGGTGGGGCGCAGTTTGGAGCCTAGTTTGGGGCGGAGGGCGGCAG
GCTTGGATAGATTGGTGGGAATTGTGAGCGACATGGTTGGATGTTTGGAAAGGGTGTGTGAGAATGGAGTGTAGGGTGGTAAGAGAAGTAAGAAAGGTTT
TTAGATTCTGATAGAGGCAGATTGGTGGTTGTTAACTAAGGAGAGTGTTGTGGATTGTGGATAAGGTGAGGAAAGTGAAGAAGCTGAGTTGGATTCTCGT
TATTGGTTC