Detailed information on CNT3086112


BLAST search results

BLAST vs Swiss-Prot:
sp|P14226|PSBO_PEA, E-value = 3e-89

BLAST vs NONCODE:
NONGMAT000837, E-value = 3e-116

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30515312Vigna radiataJuglans regia44.4817.5285.04274forward
CNT30700663Vigna radiataQuercus lobata44.1651.3283.09272forward
CNT30727933Vigna radiataCorchorus capsularis65.5827.0283.42404forward
CNT30525147Vigna radiataPhaseolus vulgaris39.6139.8795.9244forward
CNT30711968Vigna radiataGlycine max60.8851.9491.73375forward
CNT30147296Vigna radiataMedicago truncatula67.5372.8583.89416forward
CNT30621504Vigna radiataCajanus cajan28.911.2991.01178forward
CNT30121175Vigna radiataCitrus clementina21.9229.6182.96135forward
CNT3051042Vigna radiataCucumis sativus50.9757.6179.94314forward

Expression of CNT3086112

Peptides detected in this lncRNA

>peptide 1 (46 aa)
PLPLGSKKELPRYDGTRNCPPKLSGFPDATNCLMVKRKGTRSPPGS*

>peptide 2 (81 aa)
MSFVFWNSNGAFLATPSAFTVNDVGSRHNFLALYFPALKANESTPPSMVGHWFAVPNQKPLKWSEGTLAAKCWFCPTWWLA*

>peptide 3 (32 aa)
PFPWGPRKSFHGMMAPETAPQSSLASLTPPTA*

Sequence

>CNT3086112
ACCCCTTCCCTTGGGGTCCAAGAAAGAGCTTCCACGGTATGATGGCACCAGAAACTGCCCCCCAAAGCTCTCTGGCTTCCCTGACGCCACCAACTGCTTG
ATGGTGAAGAGGAAGGGCACACGTTCGCCACCAGGTAGCTGAACCGTCACGGCTGCGTAGTCAATGCCATCTTTCTCCTCAAACTTGACTGTGCCATCGG
GAGACACCTCAAAGGGTCCCTCGATCTCATCAAGAGTGTAGGTCAAACGTGTCATGAGCTTTGTGTTTTGGAACTCTAATGGGGCGTTCTTGGCCACACC
CTCAGCCTTCACTGTGAATGACGTAGGCTCAAGGCATAACTTCTTGGCATTGTATTTTCCTGCCTTGAAGGCAAATGAGTCCACTCCACCTTCAATGGTT
GGACACTGGTTTGCTGTTCCAAACCAAAAGCCTTTGAAATGGAGTGAGGGGACTTTAGCTGCAAAGTGTTGGTTCTGCCCAACTTGGTGGCTTGCATGAA
AGTAGCTGCTGGTTGTAGTGACGCTGCCATTGCCACCAATTCCTCAGTGTTTCTGTGTGTGAGGTCTTGAAAGAAAGCAGTTTGTAAGTGTTTTTGGAGA
GTGGAGAGAGTAGAAT