Detailed information on CNT3086026


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30678495Vigna radiataSetaria viridis23.8643.3281.4172forward
CNT30618119Vigna radiataSesamum indicum22.1931.1980.62160forward
CNT3019440Vigna radiataCitrullus lanatus34.6765.9680250forward
CNT3091235Vigna radiataSolanum tuberosum22.1913.3680160forward
CNT30298665Vigna radiataTriticum aestivum22.3324.8883.23161forward
CNT30540068Vigna radiataBrassica napus34.9534.2979.37252forward
CNT30264705Vigna radiataBrassica rapa34.9530.0479.37252forward
CNT30684883Vigna radiataTriticum urartu22.3326.7483.23161forward
CNT3038681Vigna radiataCucumis melo18.0332.4281.54130forward
CNT30579037Vigna radiataEchinochloa crusgalli22.7517.3584.76164forward

Expression of CNT3086026

Peptides detected in this lncRNA

>peptide 1 (71 aa)
MEERARAAEKAFRSEDMLLLLSELLLGVALQTMVGRSLEPSLGRRAAGLDRLVGIVSDMVGCLERVCENGV*

>peptide 2 (52 aa)
MYRNRNPGVMNSPQCLWSPLTIRCGWRRGRGRRRRPSDRRICCCCCRSCCWE*

Sequence

>CNT3086026
GAAGAAAGAAAAAAAAGCAAAGTGAATAATAATGAGGGAGGAAAAAAAAGCACAGAAATCGAAAGCGAGAGAGAGTGAAGAAGGGACCTTGGGAAGGGAA
TGAATTGGGCTAAACATCCTTGGCAATGAGGTCACCGTTGATGAGCTCTCTGTAGGCAGCAACGGGCCAACTGAACCCCCGGAAGAGCAAGCGAGAGGCG
AGAGGAACGTCGATGATGATCTCCTTCATCGTCGGTTTTTTCTCATCCCTGATGGCAATAAGGTAGCTCCGACCCACCCACCCGATCCACCCGGCGATGT
ACAGGAATAGGAACCCAGGAGTGATGAACTCGCCCCAGTGCCTCTGGTCCCCGCTCACGATCAGGTGCGGATGGAGGAGAGGGCGAGGGCGGCGGAGAAG
GCCTTCAGATCGGAGGATATGTTGTTGTTGTTGTCGGAGTTGTTGTTGGGAGTAGCACTGCAGACGATGGTGGGGCGCAGTTTGGAGCCTAGTTTGGGGC
GGAGGGCGGCAGGCTTGGATAGATTGGTGGGAATTGTGAGCGACATGGTTGGATGTTTGGAAAGGGTGTGTGAGAATGGAGTGTAGGGTGGTAAGAGAAG
TAAGAAAGGTTTTTAGATTCTGATAGAGGCAGATTGGTGGTTGTTAACTAAGGAGAGTGTTGTGGATTGTGGATAAGGTGAGGAAAGTGAAGAAGCTGAG
TTGGATTCTCGTTATTGGTTC