Detailed information on CNT3085996


BLAST search results

BLAST vs Swiss-Prot:
sp|P69322|UBIQP_PEA, E-value = 0.0

BLAST vs NONCODE:
NONMTRT001024, E-value = 2e-178

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30525259Vigna radiataPhaseolus vulgaris86.4373.8888.731242forward
CNT30629001Vigna radiataVigna unguiculata82.7497.1488.141189forward

Expression of CNT3085996

Peptides detected in this lncRNA

>peptide 1 (77 aa)
MQGRFLLNIVVCQGTTIFQLLPGKNKPLLIWWYALLVLNLCLHIINCIRAFHLQGNCFPCQSLHKYLHSTTKPQHQV*

>peptide 2 (52 aa)
QKYGTGERPYIRGHKTIRKRHKLEAYLSNKQIYKILTYIVYIKKIHYPYINI*

>peptide 3 (30 aa)
MVFPVKVFTKICMPPRSLKTKCKVDSFCML*

>peptide 4 (50 aa)
MPSLSWIFALTLSMVSELSTSKVMVFPVKVFTKICIPPLNRSTKWRVDSF*

Sequence

>CNT3085996
CAGAAATATGGTACGGGCGAAAGGCCATACATAAGAGGCCATAAAACAATCAGAAAACGGCACAAACTGGAGGCTTATTTAAGCAACAAACAAATATATA
AAATACTCACATATATAGTATATATAAAAAAAATACATTACCCATATATAAATATATAAAAAGCTATTTCTTAGTAGTTAACAAACAATAGCGATGATAC
ACACATATACTAGTCTTAGAACATAAGAAAAACACCCAACCAGGAACTGCAACACACGATTTCAATTGACACTGGACATAATAGACACGAGGCTTAGAAA
CCACCGCGAAGGCGAAGAACAAGATGCAGGGTAGATTCCTTCTGAATATTGTAGTCTGCCAAGGTACGACCATCTTCCAATTGCTTCCCGGCAAAAATAA
GCCTCTGTTGATCTGGTGGTATGCCCTCCTTGTCCTGAATCTTTGTCTTCACATTATCAATTGTATCAGAGCTTTCCACCTCCAAGGTAATTGTTTTCCC
TGTCAGAGTCTTCACAAATATCTGCATTCCACCACGAAGCCTCAACACCAAGTGTAGAGTGGATTCCTTCTGGATGTTATAATCTGCAAGGGTACGCCCA
TCTTCCAGCTGCTTCCCAGCAAAGATAAGTCTCTGCTGGTCCGGTGGAATGCCTTCCTTGTCCTGAATCTTTGCCTTTACATTGTCAATAGTGTCAGAGC
TTTCAACCTCCAGAGTTATGGTTTTCCCGGTTAAAGTCTTCACAAAAATCTGCATGCCACCACGAAGCCTCAAAACCAAGTGCAAAGTGGATTCTTTCTG
TATGTTATAATCCGCAAGGGTCCTTCCGTCTTCAAGCTGTTTCCCGGCAAAGATAAGCCTCTGTTGATCTGGGGGTATACCCTCCTTATCCTGAATCTTT
GTTTTCACATTGTCAATTGTATCTGAACTCTCCACTTCCAAGGTTATGGTCTTTCCTGTCAAAGTCTTGACAAAAATTTGCATACCACCTCTCAAACGAA
GCACCAAGTGAAGGGTTGACTCCTTCTGAATATTGTAATCAGCAAGGGTCCTTCCATCCTCAAGTTGTTTACCAGCAAAAATAAGCCTCTGTTGATCCGG
AGGGATGCCCTCTTTGTCTTGGATCTTCGCCTTGACATTATCAATGGTATCTGAACTCTCCACCTCCAAGGTTATGGTTTTTCCAGTCAAAGTCTTTACA
AAAATCTGCATACCACCCCTCAACCGAAGCACCAAGTGGAGGGTGGACTCCTTCTGAATATTGTAATCGGCCAGGGTTCTCCCATCCTCAAGCTGTTTAC
CAGCAAAAATCAGCCTTTGCTGATCCGGAGGGATACCCTCTTTGTCCTGGATCTTAGCCTTGACATTATCAATGGTGTCAGACGATTCTACTTCAAGGGT
TATGGTCTTGCCAGTCAAAGTTTTCACAAAGATCTGC