Detailed information on CNT3084043


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30316498Vigna radiataCorylus avellana6.3826.5787.6489forward
CNT3036594Vigna radiataCucumis melo5.7327.1286.2580forward

Expression of CNT3084043

Peptides detected in this lncRNA

>peptide 1 (32 aa)
MHNPPSSVSIPASPLKRNINSKPKSHSSSSKP*

>peptide 2 (38 aa)
MINKTRKIRSNQKITNTKEITKSLQLKSQLHFLIKKLT*

>peptide 3 (70 aa)
PYQLATINSCSQCHKLVDRQMRISLKEVQHLYEEMRLYTDGVMMQQVGKANVLLNLDFLVYHKIACELFQ*

>peptide 4 (39 aa)
MATVVALADTGHMCRLCFHWSPPHPCIILHLPCRSQLRP*

>peptide 5 (50 aa)
MQLKLREERIPMHKQCQITQQRFSYQMLTATITTQKRFKNRNFCQNHIRG*

Sequence

>CNT3084043
GTCCTTATCAGTTAGCCACCATAAACAGTTGTTCTCAATGTCATAAACTCGTCGACAGACAAATGCGGATATCCCTGAAGGAAGTTCAACACCTTTACGA
AGAAATGCGACTTTACACGGATGGAGTAATGATGCAGCAGGTCGGTAAAGCCAATGTACTTCTAAACTTGGACTTTCTTGTTTATCATAAGATAGCTTGC
GAATTATTCCAATAAAAGGAGGGGAGTCCCTAGGTGGCTTGAAGAGTGCACAATCACCAGCGCGAATCTTGCGTCCATCCTACAATGATTATGTACAGTG
TTTAAATAACTAAAATCTACAAATATTCAAGCAACAGACAATGGTATTTTATAGAAATATATTACGATCGTAGATGCAATTAAAACTAAGAGAAGAAAGA
ATCCCAATGCATAAACAATGTCAGATAACACAACAAAGATTTAGTTATCAAATGCTGACAGCAACAATTACAACCCAAAAGAGGTTCAAAAATAGGAATT
TTTGCCAGAATCACATTCGTGGATAAATTTATAATCAGATACCATGCATACAATTTACACTCAGAATTTACAACGAACATTCAATAGCATAGTGGAGCAG
TGAATGTTGATAATTAAAAATAACATTACAAACAATAAATAAGGGGAGAACGCAAACTTAAAAAAATAAAAATCACAAAAAACAGTTAACATTTTCCCCA
AATCAGTAGCCCCATATCAAGACCACAACAACATCTTCCTAATTTCCATCATTCACACACAAGTATTCTCTAATATCAAAAAAAGAAAACAAATAAATAA
AAACCCACAACTCATATAGATTAAGATCGAGAAAAACAAGGACACACAACAGATAAAAACCTTTATGATAAACAAAACCAGAAAAATTAGGTCAAACCAG
AAAATCACGAACACAAAGGAGATTACCAAGTCTCTTCAATTAAAATCACAACTACACTTTTTAATTAAAAAATTGACATAATCGAACAGCCAAAAAGTGT
CTGGAGAGAAAATTGATCGAAAACGCAGTGAAAGATTGAGAACGGTTTAGATTTATATATATATATTTATATATACTTTGCATATAAATTGAGACGGTGA
AGAATCGATGGCTACAGTGGTCGCGTTAGCAGATACAGGCCACATGTGCCGATTGTGTTTCCACTGGTCACCACCACACCCATGCATAATCCTCCATCTT
CCGTGTCGATCCCAGCTTCGCCCCTGAAAAGAAACATCAATTCGAAACCGAAATCGCACTCCTCGTCTTCGAAACCCTAGATTTGGAACCACCACTGAAG
GGGGAAACCCTAGATCAAGAACGGCATCGCAGATCTCCTCCTCCAATCCGCCTTCGGCGAGGTAGTAAAAGGGGATTTAAGGACTCGGTTACGTG