Detailed information on CNT3083687


BLAST search results

BLAST vs Swiss-Prot:
sp|P46293|RS16_GOSHI, E-value = 3e-91

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30696918Vigna radiataOryza sativa19.8737.8883.6189forward
CNT30515426Vigna radiataJuglans regia43.2231.2886.13411forward
CNT30615807Vigna radiataSesamum indicum10.344.7584.6998forward
CNT3043803Vigna radiataPrunus dulcis13.9925.3885.71133forward
CNT30391876Vigna radiataTriticum turgidum6.6228.1287.363forward
CNT30568235Vigna radiataActinidia chinensis22.571.5787.38214forward
CNT30555554Vigna radiataOryza glaberrima19.0322.1585.08181forward
CNT30438780Vigna radiataAegilops tauschii21.6625.6581.55206forward
CNT30247768Vigna radiataAvena sativa21.8734.2181.73208forward
CNT30663140Vigna radiataTriticum dicoccoides21.5629.7182.44205forward
CNT30472632Vigna radiataSaccharum spontaneum21.454.1783.33204forward
CNT30136796Vigna radiataLolium perenne21.5630.0180.98205forward
CNT30232050Vigna radiataAnanas comosus26.522.1281.35252forward
CNT30625853Vigna radiataDaucus carota43.5332.2480.68414forward
CNT30620437Vigna radiataCajanus cajan16.5122.0289.17157forward
CNT30120766Vigna radiataCitrus clementina22.439.3782.16213forward
CNT30104226Vigna radiataOryza rufipogon10.0920.0885.4296forward
CNT30581659Vigna radiataEchinochloa crusgalli19.0328.1181.22181forward
CNT30117820Vigna radiataOryza nivara21.4526.1584.31204forward

Expression of CNT3083687

Peptides detected in this lncRNA

>peptide 1 (46 aa)
MRMSTPAKRWRPRRRMGSKALKRRISGSTSSIGHPLILIRPRPRLQ*

>peptide 2 (42 aa)
MLVVSAAPSSQLGFGFLSQRLTQVTYLQFSNVYGFIYSSKVF*

>peptide 3 (46 aa)
MSTALDTDAHVNSGKTVAAEEEDGLESLEAEDLRLDELNRTSVDLD*

>peptide 4 (35 aa)
VHDTRTKCTQIDQNPKQFKHKSYKTRENVNTSPNS*

>peptide 5 (29 aa)
LFMTQEPNVRKSIKIQNNLNISHTKLEKT*

Sequence

>CNT3083687
TTGTTCATGACACAAGAACCAAATGTACGCAAATCGATCAAAATCCAAAACAATTTAAACATAAGTCATACAAAACTAGAGAAAACGTAAACACTAGCCC
AAACTCGTAATCCCTGGGAACCGGTAGAGCGGAGGCATCCAAATAGAAGCAGAAACGCAAACAAACAAAGCTATTTCCAATCAAAAATAAACAATATAAA
ATAGAGCATCCAAACAATTGTATTTAAATTAACGACAGAACTAAAACTTAACTAAAACATTATAAGAGTTTCCAAAATCCGATTAAAAACTCAGCGAAAC
AGAAAAGGCAGAGAGTACTATCAAGACATCTCGATAAAATATAAAGAAAAGGGAAAATGGACTGAAATCAACGGTAGGATTTCTGGAACCTGGCGCGAGC
ACCGCGACCACCGAACTTCTTGGGCTCGCAGCGGCGAGGATCAGCAACGAGGAGTGTGCGGTCGTACCTGACGAGGATGTCTTTGATCTCCTTCTTCGAC
TGCTCATCCACGTACTTCTGGTAATAGGCGACGAGAGCCTTGGCGATGCTTTGACGGATGGCGTAGATCTGGGAGGTATGTCCACCGCCCTTGACACGGA
TGCGCATGTCAACTCCGGCAAAACGGTGGCGGCCGAGGAGGAGGATGGGCTCGAAAGCCTTGAAGCGGAGGATCTCCGGCTCGACGAGCTCAATAGGACA
TCCGTTGATCTTGATTAGGCCGCGGCCGCGTTTGCAGTAAGTAACTGCCACCGCCGTCTTCTTGCGGCCGAAACACTGGACCTGCTCTAATGCTGGTGGT
GTCTGCTGCGCCATCTTCGCAATTAGGGTTTGGGTTTCTCTCACAGCGCCTCACTCAGGTAACCTATCTGCAATTTTCTAATGTTTATGGCTTTATATAT
TCATCGAAGGTTTTTTAGGCTGCGGAAATACCCTCGTTATCCCCCTCCACA