Detailed information on CNT3082721


BLAST search results

BLAST vs Swiss-Prot:
sp|Q96553|METK3_CATRO, E-value = 6e-45

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30673492Brassica junceaSetaria viridis63.3218.7984.7183forward
CNT30521128Brassica junceaSetaria italica63.322584.7183forward
CNT30549907Brassica junceaIpomoea triloba21.4511.5590.3262forward
CNT30515028Brassica junceaJuglans regia36.3312.3782.86105forward
CNT30373104Brassica junceaArabidopsis thaliana45.3315.6186.26131forward
CNT30266655Brassica junceaChenopodium quinoa54.6714.0682.91158forward
CNT30402638Brassica junceaBeta vulgaris77.5117.4983.04224forward
CNT30628634Brassica junceaVigna unguiculata59.1723.7583.04171forward
CNT30194995Brassica junceaPisum sativum22.496.8390.7765forward
CNT30495282Brassica junceaOlea europaea48.447.9583.57140forward
CNT30712013Brassica junceaGlycine max48.4431.3285140forward
CNT3047442Brassica junceaPrunus dulcis57.7927.5686.23167forward
CNT30158121Brassica junceaPistacia vera63.3229.2886.34183forward
CNT3090332Brassica junceaSolanum tuberosum57.7925.6983.23167forward
CNT30181754Brassica junceaSecale cereale62.9828.9385.71182forward
CNT30294498Brassica junceaTriticum aestivum60.2121.7884.48174forward
CNT30225130Brassica junceaHordeum vulgare39.126.7884.07113forward
CNT30561874Brassica junceaActinidia chinensis31.8310.4389.1392forward
CNT3086464Brassica junceaVigna radiata23.8834.1686.9669forward
CNT30508429Brassica junceaSolanum lycopersicum28.7233.684.3483forward
CNT30174161Brassica junceaTrifolium pratense20.427.4889.8359forward
CNT30144438Brassica junceaMedicago truncatula23.1813.792.5467forward
CNT30662024Brassica junceaTriticum dicoccoides57.0932.4884.24165forward
CNT30471855Brassica junceaSaccharum spontaneum63.3219.8985.25183forward
CNT30606743Brassica junceaGossypium raimondii28.727.7785.5483forward
CNT30218668Brassica junceaKalanchoe fedtschenkoi42.2131.5283.61122forward
CNT30650282Brassica junceaRosa chinensis63.3215.5385.79183forward
CNT30212612Brassica junceaHelianthus annuus24.9129.8887.572forward
CNT30624603Brassica junceaDaucus carota59.8626.2185.55173forward
CNT30681758Brassica junceaTriticum urartu60.2125.5184.48174forward
CNT30344080Brassica junceaEragrostis tef27.6827.788580reverse complement
CNT30368062Brassica junceaSorghum bicolor60.2115.8386.78174forward
CNT30620812Brassica junceaCajanus cajan68.1715.8681.73197forward
CNT30597062Brassica junceaOryza meridionalis44.2911.6487.5128forward
CNT30355133Brassica junceaLactuca sativa51.5617.0382.55149forward
CNT30421092Brassica junceaPapaver somniferum58.8225.4581.76170forward
CNT30571189Brassica junceaVitis vinifera60.2128.2586.78174forward
CNT3055164Brassica junceaAmborella trichopoda20.425.1389.8359forward
CNT3024999Brassica junceaPopulus trichocarpa78.290.483.63226forward
CNT3035650Brassica junceaCucumis melo48.4410.3987.86140forward
CNT30148817Brassica junceaBrachypodium distachyon63.3215.8385.79183forward
CNT30101810Brassica junceaOryza rufipogon60.216.8686.78174forward
CNT30116702Brassica junceaOryza nivara25.617.2187.8474forward
CNT30174546Brassica junceaVigna angularis55.7121.0579.5161forward
CNT30113343Brassica junceaFicus carica48.4439.5585140forward
CNT30725876Brassica junceaLupinus angustifolius27.688.0783.7580forward

Expression of CNT3082721

Peptides detected in this lncRNA

>peptide 1 (93 aa)
DFSKLSTDLGRKNVAQRHELRGLISGVSKHMSLVTSSNVFRALGEVTVNTLSNVWALLLDVDKDLAFAGVEDCVRDLVAKLVWVSFVDRLRCE*

>peptide 2 (46 aa)
LTSVSLAPILVARTWLRGMSSGVSSVAYPNICPWSPAPMSSGRLVK*

>peptide 3 (42 aa)
MSGLCCSMLTRTLHLQASRTASEIWSQSLSGCPSLTDSDVNRK

Sequence

>CNT3082721
CTGACTTCAGTAAGCTTAGCACCGATCTTGGTCGCAAGAACGTGGCTCAGAGGCATGAGCTCAGGGGTCTCATCAGTGGCGTATCCAAACATATGTCCCT
GGTCACCAGCTCCAATGTCTTCCGGGCGCTTGGTGAAGTGACCGTGAACACCTTGAGCAATGTCTGGGCTCTGCTGCTCGATGTTGACAAGGACCTTGCA
TTTGCAGGCGTCGAGGACTGCGTCAGAGATCTGGTCGCAAAGCTTGTCTGGGTGTCCTTCGTTGACAGACTCAGATGTGAATAGGAAAG