Detailed information on CNT3082246


BLAST search results

BLAST vs Swiss-Prot:
sp|P49390|CYB_BRANA, E-value = 2e-32

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30548225Brassica junceaIpomoea triloba45.2530.4997.34376forward
CNT30378677Brassica junceaArabidopsis thaliana45.2513.72100376forward
CNT30180581Brassica junceaSecale cereale45.2516.8996.28376forward
CNT30669339Brassica junceaTriticum dicoccoides11.3139.1796.8194forward
CNT30689753Brassica junceaTriticum urartu45.2539.0996.54376forward
CNT30481172Brassica junceaChara braunii13.4833.6386.61112forward
CNT3038142Brassica junceaCucumis melo35.0242.2494.85291forward

Expression of CNT3082246

Peptides detected in this lncRNA

>peptide 1 (39 aa)
MVLPQVDIRSNLVVSNPPKATKTFLGESVENLNYAHTYF*

>peptide 2 (36 aa)
MKVNHNKKHTCPISMHITEQPAPFNISHNVFYAVES*

Sequence

>CNT3082246
TAGGCCTTGGGGGGCGGGGCCTCTTTTTTGATTTTTTAATAAAAAAGGGGGAGAGGGACCCTTTTTGATTTTTGAAGTACAGCCCTACCCTATAGTGGAG
TTATCTTTTCCCTATCTAAGCTATATCAACATAGCAAACTAGAAAACTTATCCGCTTGTCAATTCTTGGTGTAATATGTAAATGATTGGTGTCAAAATTT
TTCACTGATCAGGTGTGATCAGTCTCATCCGTGTAAGAATTAGGAATTCCTCTTCCAACTCGTCCCAGAATGGGCGTTATGGCAAAGAACAAGAAGAAAA
CCAAAGGAGAAATTTGTCCAATAGTAACAAATGGTGCTTCCACAGGTTGACATCCGATCCAACCTAGTAGTAAGCAATCCGCCAAAAGCAACCAAAACAT
TCCTTGGTGAATCGGTCGAAAACTTGAACTACGCACATACATACTTTTAAAAAAAGGTATGGCGCTAGCTAAGCTTGTAATTACTGTAGCTCCCCAAAAG
CTCATCTGACCCCAAGGTAGTACATATCCTATAAAAGCTGTCACAATCATTAATAGGAAGATTACAACTCCAAGACACCAAACAAATTCCCTAGGACTGC
TATAACTCGCATGATATAGACCACGAAAAATATGAAGGTAAACCACAATAAGAAACATACTTGCCCCATTAGCATGCATATAACGGAGCAACCAGCCCCC
TTCAACATCTCTCATAATGTGTTCTACGCTGTTGAAAGCTAAATCCACATGAGGTGTGTAATGCATAGCTAAAAAAACGCCAGTCACTATCTGAATGACT
AAACAAATACCAGCTAACGGACCGAACCCCC