Detailed information on CNT308186


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT308186

Peptides detected in this lncRNA

>peptide 1 (31 aa)
RRTGLSKSMDSGANSSPGIEQGNAGREDMRT*

>peptide 2 (95 aa)
ADWTEQIDGFGGEFLAGDRAGECRKRRHEDIRLFSCSCGSSVGVFRAGNWRLPSSIDFDDIAFGAGKRLRANFHSSAIADLLHISAAKQLYAAAT*

Sequence

>CNT308186
CGGCGGACTGGACTGAGCAAATCGATGGATTCGGGGGCGAATTCCTCGCCGGGGATCGAGCAGGGGAATGCAGGAAGAGAAGACATGAGGACATAAGACT
TTTTTCTTGTTCGTGCGGTTCTTCGGTGGGGGTCTTCCGTGCAGGCAACTGGAGGCTTCCTTCGTCGATCGACTTCGACGATATCGCCTTCGGTGCAGGC
AAGCGACTCCGCGCCAACTTCCATAGCTCCGCCATTGCCGACCTTCTCCACATCTCCGCAGCCAAGCAACTCTACGCCGCCGCAACATAGGACTTCCCAG
ATCGAGGTCCTCCTCATCGCCGCCACCGACCTACTCCGCGCTGCCGCAGCCAAGGTCATCCGCGCTGCCGGACCACCGTAGTCTGCATCGGGTTGTGCAG
CTTCTCTCACGACAAGGACATATAGCGGATCAACAGTGAACCACCAGCTTTAGCGGTCGAAGGAGTACGCCTGTATTTTACCGGACCTTATAGCGTTCGT
TGTTGGAGAGGATAGAGAGCGTATGAAACGGTAAATATAGCGGACAGCATGTTTTACCGATCGTTGCTGGAGACAGCCTGATAATTAGAAAAATCTACTC
CTGTGAGACATGTAGCAGTCTCATAAGTCCAGAGTACAGGGGCATCGGCCACAGCGATGTAGGCCGATACATCAGCATGTACTTGTTCTATGTCATCGCC
TACCCATTGTATTAACATTTGATGTAATGTAGAAGGTATACATTGATTGGCGTGAATCCAATCTCTGCCTAGGATTAAACTATAATTTCCTTCTACATCA
GCGATGAAGAATGCAGC