Detailed information on CNT30799


BLAST search results

BLAST vs Swiss-Prot:
sp|Q10HD0|CB23_ORYSJ, E-value = 5e-122

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30522203Zea maysSetaria italica65.1859.5295.56541forward
CNT30187133Zea maysSecale cereale43.6151.8691.99362forward
CNT30393827Zea maysTriticum turgidum43.6139.9690.06362forward
CNT30556099Zea maysOryza glaberrima42.5336.2191.5353forward
CNT30665498Zea maysTriticum dicoccoides43.6152.5491.16362forward
CNT30684718Zea maysTriticum urartu43.6153.0889.78362forward
CNT30579510Zea maysEchinochloa crusgalli65.1848.2694.64541forward
CNT30116671Zea maysOryza nivara42.5342.1791.22353forward
CNT30603927Zea maysOryza punctata42.6544.6492.37354forward

Expression of CNT30799

Peptides detected in this lncRNA

>peptide 1 (41 aa)
MSPGRPRGPRCPTRSRRGTRRSGTTASARRTGQDTWGDQGRT

>peptide 2 (31 aa)
MAQAIDRLIHPLMTIHASVLSLHRPLTAGSH*

>peptide 3 (58 aa)
MGPLPVTMACTKKPNMENMARRPFLSSFTLSSAAPMSTTWHAQMARMLCACTRLGFPR*

>peptide 4 (47 aa)
MDLMVVHMYGVAQSVSCRGRSSWRMPRRCWRRGRRRGRRGSRWGPCR*

Sequence

>CNT30799
GATCGATTCAAAAATGAATGGCACAGGCCATCGATAGATTGATTCATCCACTGATGACGATACATGCGTCTGTGCTTAGTTTACATCGACCGCTTACAGC
AGGCAGCCATTGACATTGATTGATGAGCACACATCGATCATGAGCATACGCCGGCTGGTGCAACTACTACACGCCTACGATCTGAACAAGTAGAGTACAG
AGAAGACCACACTGTTCACTCGACGGACGGACGAACGAATGGATGGATCTGATGGTAGTACACATGTACGGCGTTGCTCAGTCAGTTAGTTGCCGGGGAC
GAAGTTCGTGGCGTATGCCCAGGCGTTGTTGGCGACGGGGTCGGCGACGTGGTCGAAGAGGTTCTCGATGGGGCCCTTGCCGGTGACGATGGCCTGCACG
AAGAAGCCGAACATGGAGAACATGGCAAGGCGGCCGTTCTTGAGCTCCTTCACCTTGAGCTCGGCGGCGCCCATGAGCACCACCTGGCACGCCCAGATGG
CCAGGATGCTCTGTGCGTGCACCAGGTTGGGGTTCCCCAGGTAGTCCAGCCCGCCCTCCGAGAAGATCTGCGCGCCGGCCTTGAACCACACCGCCTCGCC
GAACTTGACGCCGTTCTTGGCCAGGATCTCCGGGAACACGCAGCCCAGCGCGCCCAGCATCGCCCACCGGGAGTGGATCACCTCCAGCTCCCGGTTGCGC
GCGAATGTCTCCGGGTCGGCCGAGAGGCCCGCGGTGTCCCACCCGTAGTCGCCGGGGAACTCGCCGGTCAGGTACGACGGCGTCTGCTCGGAGAACGGGC
CAAGATACTTGGGGCGATCAGGGCCGTACC