Detailed information on CNT3079812


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT3079812

Peptides detected in this lncRNA

>peptide 1 (30 aa)
MDNNMIIKSKISYFLILFLLLHQYKSVTYI*

>peptide 2 (35 aa)
KKTNLSTLLSPPMRFPSQLKVQKSKSIPVKTVTMA*

>peptide 3 (36 aa)
MWPFPREIFCGLDQNKAHKTQYICYPAWVKSLLKCP*

>peptide 4 (83 aa)
KKNKSLDASFPTHAISISIEGSEIKINTGKDCNDGLKIFNDEGSKLIWKQNQTVGWKLGRSNKDFSYSCLLRLFFQTFVLQII*

>peptide 5 (44 aa)
MYSRRKLNIPNTTIIEMSFVYGQQHDNKIKDKLLPDTFSSFTSI*

>peptide 6 (43 aa)
MIWTWEQWNLPHTYAHIPVLLIKFCRLHNVAFSKRDILWTGPK*

Sequence

>CNT3079812
AAAAAAAACAAATCTCTCGACGCTTCTTTCCCCACCCATGCGATTTCCATCTCAATTGAAGGTTCAGAAATCAAAATCAATACCGGTAAAGACTGTAACG
ATGGCTTGAAGATCTTCAACGATGAGGGTAGCAAATTGATTTGGAAACAAAATCAAACTGTTGGTTGGAAACTCGGTAGATCCAACAAGGACTTCTCGTA
TTCCTGTCTCTTAAGGTTATTTTTTCAAACATTTGTTCTTCAGATTATATAGATCGTTTTCACAGCTCTAACATCGATGAAGATCTACATAAATATTTGG
TAATTGTTTTTTTTTTGCATGTGAGATTGGAATGGTTTCCAAGAATCCGACGAAGTTCAGAAACGGGTCAAAATCTTATCAATTAAAATTGATTCGACAA
CATCTCTGAGTAAATAAAAGCCAAGTAACACTGGAAAGAAAAAACATAACGTACTTTCAGAGAAAATATTCATATTCCAAATACAACAATCATAGATATG
TCATTCTTCATTGGACAACAACATGATCATAAAGTCAAAGATAAGTTACTTCCTTGTAATTTTTCTTCTTTTACATTAATATAAAGTGTAATTTCCATAT
AAATATAACATGATTAGTTATAGATTTAATCACAAGGGATATACATGACAAACTTTAGGTGTGTTATATTTGAGTCCGTTGACTAAAATTTGTTACAATT
CTTGTCCTGGTCATGCAGTTAATATTTTAAAGACACTGGTTTATTCTGCTGAAGGACCATGGGACAAATACATAACGCCAAAAACAATACGAACCAATAC
GAATAATGTACTCTCGGAGAAAATTAAATATTCCGAATACAACTATCATAGAGATGTCATTCGTCTATGGACAACAACATGATAATAAAATCAAAGATAA
GTTACTTCCTGATACTTTTTCTTCTTTTACATCAATATAAAAGTGTAACTTACATATAAATATAGCTTGATTAGTTACAGATTTATTGACATGGGATATA
GATGAGAACTTTAGGTGTTTTATATTTGAGTCCGTTGACTAAAATGTGTTTCAATTCTTGACATGGTCATGCAGTTAAAAGTTTGAAGACACAGATTAAT
TCAGCTGAAGGACCATGGGACAAATACATAACGCCAAAGCAATAAGAACCAATAAGAGCTGGTTTACTTAAGGTGCAAGAAATCAGTAGATGATTTGGAC
ATGGGAACAATGGAATCTCCCTCATACATACGCCCATATACCAGTCCTCTTGATAAAGTTTTGCAGATTACATAATGTGGCCTTTTCCAAGAGAGATATT
CTGTGGACTGGACCAAAATAAAGCACATAAGACCCAATATATATGTTATCCAGCGTGGGTAAAGAGTTTACTTAAATGCCCTTAATGAAAGCACGAAAAT
GCTTTGTAATTCAGTCTAGACGTTATTAGAAAAATGGTAGTTTTAGGTGAAAAAGCCAATAGGATCCTGCTTTAAGAGTATAAATTAGTATAATTTCTTT
GGGAAATTTCACTTCTACCACTTTAAAGATACCATAATTCATATTTACCACTAACCAAAGAATATTTTCAAAAACACCCTCTTCATTAAAAGGTAAAAGA
CAG