Detailed information on CNT3079681


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30372643Brassica junceaArabidopsis thaliana18.8220.5892.9399forward
CNT30543691Brassica junceaBrassica napus19.5824.9497.09103forward
CNT30261195Brassica junceaBrassica rapa16.1639.7291.7685reverse complement

Expression of CNT3079681

Peptides detected in this lncRNA

>peptide 1 (48 aa)
MNPGLGPEVGGQRNCTLLPEPSREQISCSRTNSMSRRHFFFLLSGCDN*

Sequence

>CNT3079681
ACATAAGTGAATTGAACCATGGAACAATGAAACACAAGATTACAACATAATGTGATGAGATGCTTAACATCTCATTAGAAACTAAACATATAGACTAAAT
TGTTTGAAATGGTAAAAGAAGAGAGATTGAGAAAATGATAGTTATAATCGAGATTTCTGCTTCTCTGTGTCTGGATTGCATCTTAAAGAAAATGTAATTG
TAGCTAAAACACATGAAGAACAGTCGAATAACCAAGAAGAAGAAACAGCCAAAAAAAGTTCTGAGCAAAACACTGGGGGAAGGTAAGTAGAAAACTAATA
GCCACCCTTGAGATCGTTGACGACATCGTAAGGGATAGGGGTGACAGTCTCCAAGGTCATACCCTCAACCATGAATCCTGGTTTGGGTCCTGAGGTAGGT
GGACAACGGAATTGTACCCTTCTTCCTGAACCCTCTCGCGAACAGATCTCTTGTTCTCGCACGAACTCCATGTCCCGCCGGCATTTTTTCTTCCTCTTGA
GTGGATGCGACAACTAAAACTCGCCT