Detailed information on CNT3078925


BLAST search results

BLAST vs Swiss-Prot:
sp|Q8W4H7|EF1A2_ARATH, E-value = 0.0

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30316757Brassica junceaCorylus avellana64.7363.2786.81758forward
CNT30546799Brassica junceaIpomoea triloba73.9570.5287.07866forward
CNT30618435Brassica junceaSesamum indicum29.7270.8885.06348forward
CNT3021028Brassica junceaCitrullus lanatus70.3766.3483.86824forward
CNT30160120Brassica junceaPistacia vera73.6169.3587.01862forward
CNT30637620Brassica junceaCapsicum annuum21.6113.1888.14253forward
CNT30224132Brassica junceaHordeum vulgare36.1261.6685.34423forward
CNT30598511Brassica junceaFraxinus excelsior40.8273.4386.19478forward
CNT30350898Brassica junceaEragrostis tef74.4778.2886.12872forward
CNT30101006Brassica junceaOryza rufipogon33.5656.4786.01393forward
CNT30724026Brassica junceaLupinus angustifolius71.9958.5485.29843forward

Expression of CNT3078925

Peptides detected in this lncRNA

>peptide 1 (81 aa)
MTPTATVCLMSLTAKRPRGGYSEKVSTTMGLVGVIFTIPASPFFKNLGSFSISLPERLSILVRISENLTAMWEVWQSRTGA*

>peptide 2 (93 aa)
MMMTWEVKLAAPLAGSSLELDATYPRLRSLTATFLTLKPTLSPGSASTRDSWCISTDLTSVVNPEGAKVTTIPGLSIPVSTRPTGTVPIPPIL*

Sequence

>CNT3078925
GACACGACAATAACCGCAGGAATACCATATTCATTATAAAAGAGTATCCAAAATAGTTCAGAATCCGAAAGCAAAAAGTAAAAGAAAAAAGGAAGCTAGA
GTGCTGAGTAGCTTCGCCACCTCCGATCAAGAACCCAGTTACGAGAACAGAGCTCCGACGGGGAAGAAACAAACCTGAAACACAAACATGCGACCAAATA
CCATACTAAAGTAAAAAAACTAAAATTGTCTTTTGATTCAACTGCGGATGATAGAGTTTTCCTCGAGGTAGTTCACTTGGCACCCTTCTTGACGGCAGCC
TTGGTAACCTTGGCTCCGGTCGGGTCCTTCTTGTCAACGCTCTTGATGACACCGACTGCAACAGTCTGCCTCATGTCCCTCACAGCAAAACGTCCAAGAG
GTGGGTACTCAGAGAAGGTCTCAACAACCATGGGCTTGGTCGGAGTCATCTTCACCATACCAGCGTCACCATTCTTCAAGAACTTGGGCTCCTTCTCGAT
CTCTTTACCAGAACGCCTGTCAATCTTGGTGAGGATCTCAGAGAACTTGACGGCAATGTGGGAAGTGTGGCAGTCGAGAACTGGAGCGTAACCGTTACCA
ATCTGACCAGGGTGGTTCATGATGATGACCTGGGAAGTGAAGTTGGCAGCACCCTTAGCTGGGTCATCCTTGGAGTTGGACGCAACATACCCACGCTTGA
GATCCTTGACAGCGACATTCTTGACATTGAAACCCACGTTGTCACCTGGAAGTGCCTCCACAAGAGACTCGTGGTGCATCTCCACGGACTTAACCTCAGT
GGTCAACCCTGAAGGAGCAAAGGTCACAACCATACCAGGCTTGAGCATACCTGTCTCAACACGACCCACTGGCACCGTTCCAATACCACCAATCTTGTAG
ACATCCTGAAGTGGGAGACGAAGCGGCTTGTCTGATGGCCTCTTGGGCTCGTTGATCTGGTCAAGTGCCTCAAGGAGAGTTGGTCCCTTGTACCAGTCGA
GGTTGGTGGACCTCTCAATCATGTTGTCACCCTCAAAACCAGAGATGGGGACGAATGGGATTTTGTCAGGGTTGTACCCAACCTTCTTCAAGTAGGAAGA
CACTTCCTTGATAATCTCATCGTACCTAGCCTTAGAGTATTTGGGGGTAGTGGCATCCATCTGAAACAAGG